SecReT4
Protein ID: 148558683
T4SS name [ID]VirB [371]
Gene symbol-
Locus tagBOV_A0058
StrainBrucella ovis ATCC 25840
Repliconchromosome II [GenBank: NC_009504] [Browse all T4SS(s) in this replicon]
Location [Strand]60677..61720 [-]
Producttype IV secretion system protein VirB6
Component typeVirB6
UniProt IDA5VTI4
KEGG IDbov:BOV_A0058
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.1e-47, Aligned region: 42..269
Protein Sequence: 347 a.a.     [Download]
>gi|148558683|ref|YP_001257139.1| type IV secretion system protein VirB6 [Brucella ovis ATCC 25840]
MVNPVIFEFIGTSIHNQLNNYVTMVASNTMNMIATTAVLAGGLYYTAMGILMSVGRIEGPFSQLVISCIK
FMLIAAFALNISTYSEWVIDTVHNMESGFADAFAGNHGTPSSTIYQTLDNSLGKGWNIAAMLFEKGDNRG
LTQIVQGFSELLLSFLVAGSTLILAGPTGAMIVATNAVIAILLGIGPLFILALGWAPTRGFFDRWFGAIV
TSILQVALLSAVLSISSAIFSRMVAAINLASATQSTLFSCLSLTAVTIVMPYMMYKVYEYGGILGSSISA
ATISLGSLAVNTATSGGGAMTSIFSGSSGGGGSGSAKAGGESSYSAGGNAMWSPAYRQHVLGQFNRD
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|148557829|ref|NC_009504.1|:c61720-60677 Brucella ovis ATCC 25840 chromosome II, complete sequence
ATGGTTAATCCTGTAATCTTTGAGTTCATCGGCACTTCGATCCACAACCAGTTGAACAATTACGTGACTA
TGGTGGCATCCAACACCATGAATATGATTGCCACGACTGCTGTCCTCGCCGGTGGCCTCTACTATACCGC
CATGGGCATATTGATGTCTGTGGGGCGGATCGAAGGGCCGTTTTCGCAACTCGTCATAAGCTGTATTAAA
TTCATGCTGATTGCTGCTTTTGCGCTCAATATCAGCACCTATTCGGAGTGGGTGATCGATACGGTGCACA
ACATGGAGTCCGGATTTGCCGACGCCTTTGCCGGCAATCACGGCACCCCTTCCAGCACGATCTACCAGAC
CCTCGACAATTCGTTGGGCAAGGGGTGGAACATCGCAGCCATGCTCTTTGAGAAAGGCGATAATCGCGGC
CTGACCCAGATCGTGCAGGGCTTTTCAGAACTGTTACTGTCATTCCTGGTAGCCGGCTCAACGCTTATCC
TTGCAGGCCCGACTGGTGCGATGATCGTCGCAACCAATGCGGTGATCGCGATCCTGCTCGGAATCGGCCC
TCTCTTCATCCTCGCCCTTGGCTGGGCGCCGACAAGGGGCTTCTTCGATCGCTGGTTCGGGGCCATCGTC
ACATCAATCCTTCAGGTCGCGCTTTTGTCGGCCGTGCTATCTATATCGAGTGCAATCTTCAGCCGCATGG
TGGCGGCCATCAATTTGGCTTCCGCAACACAAAGCACGCTCTTTTCCTGCCTCTCACTGACCGCTGTAAC
GATTGTCATGCCGTATATGATGTACAAGGTCTATGAATACGGTGGCATCCTGGGCAGCAGCATATCGGCG
GCCACGATCTCCCTCGGCTCACTTGCAGTCAATACCGCGACATCTGGTGGTGGCGCTATGACGAGCATAT
TCAGCGGATCATCCGGCGGCGGGGGTTCCGGCTCGGCGAAGGCGGGCGGGGAAAGCAGTTATTCGGCTGG
TGGCAACGCCATGTGGAGCCCGGCTTACCGGCAACACGTGCTCGGCCAGTTCAACAGGGATTAG
 Primer design