SecReT4
Protein ID: 148558741
T4SS name [ID]VirB [371]
Gene symbolvirB5
Locus tagBOV_A0059
StrainBrucella ovis ATCC 25840
Repliconchromosome II [GenBank: NC_009504] [Browse all T4SS(s) in this replicon]
Location [Strand]61904..62620 [-]
ProductP-type DNA transfer protein VirB5
Component typeVirB5
UniProt IDA5VTI5
KEGG IDbov:BOV_A0059
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 1.8e-65, Aligned region: 21..217
DUF4141 [PF13605], Evalue: 8.4e-07, Aligned region: 1..43
Protein Sequence: 238 a.a.     [Download]
>gi|148558741|ref|YP_001257140.1| P-type DNA transfer protein VirB5 [Brucella ovis ATCC 25840]
MKKIILSFAFALTVTSTAHAQLPVTDAGSIAQNLANHLEQMVKFAQQIEQLKQQFEQQKMQFDALTGNRG
LGDILRDSTLRSYLPHNWRDLYEAVMSGGYLAAAGETANLLRKSQVYDPCASISDKDQRIACEAKVVKPV
QDKVMTSKAYDATDKRLQEIESLMQEINKTGDPKAIAELQGRIESENAMIQNEDTRLHLYQQMAEAQDKL
LDERQHELDAKDNARRGYPQPKALEAAY
 
Nucleotide Sequence: 717 bp     [Download]
>gi|148557829|ref|NC_009504.1|:c62620-61904 Brucella ovis ATCC 25840 chromosome II, complete sequence
ATGAAGAAGATAATTCTCAGCTTCGCATTCGCCCTGACTGTAACCAGCACGGCGCACGCACAGCTCCCGG
TGACAGATGCCGGCTCCATCGCGCAGAACCTGGCCAACCATCTCGAACAGATGGTGAAGTTCGCCCAGCA
GATCGAACAACTGAAACAGCAGTTTGAACAACAGAAAATGCAGTTCGATGCCCTGACTGGCAACCGTGGC
CTTGGCGATATTCTCCGCGACTCTACGCTGCGTAGCTATCTGCCACATAACTGGCGAGATCTCTACGAAG
CGGTGATGAGCGGCGGCTACCTGGCGGCGGCTGGCGAAACGGCCAACCTCTTACGCAAAAGCCAGGTATA
CGATCCGTGTGCCTCCATCTCCGACAAAGATCAGCGCATCGCATGTGAGGCTAAAGTGGTGAAGCCGGTC
CAGGACAAGGTCATGACGTCCAAAGCCTACGACGCCACTGACAAACGCCTACAAGAGATCGAGAGCTTGA
TGCAGGAGATCAACAAGACGGGAGACCCGAAGGCGATTGCCGAATTGCAAGGCCGGATCGAAAGCGAAAA
TGCCATGATCCAAAACGAAGACACCCGCCTTCATCTCTACCAGCAGATGGCAGAGGCACAGGACAAGCTC
CTGGACGAACGCCAGCACGAATTAGACGCGAAGGATAATGCCCGGCGCGGCTATCCGCAGCCGAAAGCAC
TGGAAGCCGCCTATTAA
 Primer design