SecReT4
Protein ID: 148558751
T4SS name [ID]VirB [371]
Gene symbolvirB9
Locus tagBOV_A0056
StrainBrucella ovis ATCC 25840
Repliconchromosome II [GenBank: NC_009504] [Browse all T4SS(s) in this replicon]
Location [Strand]58752..59621 [-]
ProductP-type conjugative transfer protein VirB9
Component typeVirB9
UniProt IDA5VTI2
KEGG IDbov:BOV_A0056
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.2e-64, Aligned region: 29..259
Protein Sequence: 289 a.a.     [Download]
>gi|148558751|ref|YP_001257137.1| P-type conjugative transfer protein VirB9 [Brucella ovis ATCC 25840]
MKRFLLACILITLASPSWATKIPSGSKYDSRIQYVDYNSGDVVLVRALPGVGARIVFAPGENIEDVASGF
TQGWEFKASHNILYLKARSMTLSHSNQSIDMAPEPGKWDTNLMVTTDQRMYDFDLRLMPGRNNQRVAYRV
QFRYPAAAAAAAVAAAQKRVVQARMNARPSPVNWNYTMQVGTNSASIAPTLAYDDGRFTYLRFPNNRDFP
AAFLVAEDKSESIVNSHIDPSAPDILVLHRVAKQMVLRLGNKVIGIYNESFNPDGVPARDGTTVPGVKRV
IKSPGENLQ
 
Nucleotide Sequence: 870 bp     [Download]
>gi|148557829|ref|NC_009504.1|:c59621-58752 Brucella ovis ATCC 25840 chromosome II, complete sequence
ATGAAAAGATTCCTGCTTGCGTGCATACTGATCACGCTGGCCTCGCCCTCCTGGGCAACCAAAATCCCGT
CCGGCTCAAAATACGACAGCCGAATTCAGTATGTCGATTACAATTCCGGCGATGTCGTGCTGGTTCGGGC
CCTGCCCGGCGTTGGCGCACGCATCGTGTTTGCGCCGGGCGAGAATATTGAGGATGTCGCCTCAGGATTT
ACGCAAGGCTGGGAGTTCAAGGCGAGCCACAACATCCTGTATCTCAAGGCCCGCTCCATGACGCTCTCCC
ACTCGAACCAATCGATCGACATGGCCCCGGAACCGGGCAAGTGGGACACAAACCTGATGGTCACGACAGA
TCAGCGCATGTACGATTTCGATTTGCGCTTGATGCCCGGCCGCAACAATCAGCGTGTTGCCTATCGTGTT
CAGTTCCGCTACCCGGCGGCAGCGGCAGCGGCGGCAGTAGCAGCCGCGCAAAAGCGAGTGGTACAGGCCC
GCATGAATGCCAGACCGTCGCCGGTAAACTGGAACTACACGATGCAGGTCGGCACTAATTCGGCCAGCAT
CGCGCCCACTCTTGCCTATGACGATGGGCGGTTCACATATTTGCGCTTTCCGAACAACAGAGACTTTCCG
GCCGCTTTCCTTGTCGCCGAAGACAAGTCGGAAAGCATCGTGAACAGCCATATAGACCCGTCAGCGCCGG
ACATTCTGGTCCTGCATCGGGTCGCAAAGCAAATGGTGCTGCGCCTCGGTAACAAGGTGATTGGCATCTA
CAACGAATCCTTCAATCCTGATGGCGTTCCCGCACGCGACGGAACCACAGTGCCAGGCGTCAAGCGCGTC
ATCAAATCGCCCGGGGAGAACCTGCAATGA
 Primer design