SecReT4
Protein ID: 149930811
T4SS name [ID]Tra_F [121]
Gene symbol-
Locus tagSF0157_p85
StrainEscherichia coli plasmid pSFO157 (NC_009602)
Repliconplasmid pSFO157 [GenBank: NC_009602] [Browse all T4SS(s) in this replicon]
Location [Strand]104137..104910 [+]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDQ0E820
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.3e-78, Aligned region: 33..247
Protein Sequence: 257 a.a.     [Download]
>gi|149930811|ref|YP_001294749.1| conjugal pilus assembly protein TraF [Escherichia coli]
MKEKVMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLAVLQT
ATKRALYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAADQ
VQQRQAIAKLAEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQR
LGVKYFPAMMLVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 774 bp     [Download]
>gi|149930749|ref|NC_009602.1|:104137-104910 Escherichia coli plasmid pSFO157, complete sequence
ATGAAAGAAAAAGTGATGAAAGGAATGAAGATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTA
TTTTTCCGGCGTCAGGAAAAGATGCAGGCTGGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAAAGA
AAATAAACCAGTACCTGCAGCCCCCCGTCAGGAGCCGGACATTATGCAGAAACTGGCCGTGCTGCAGACG
GCAACAAAGCGGGCGCTGTATGAAGCCATTCTGTATCCCGGCGTGGATAATTTTGTGAAATATTTCCGGC
TGCAGAATTACTGGACTCAGCAGGCCGGGCTTTTCACCATGAGCGCCAAAAAAGCCATGCTGGCGCATCC
CGAACTGGACTATAACCTGCAGTACAGCCATTACAACGGCACGGTCCGGAACCAGCTGGCGGCAGACCAG
GTGCAGCAGCGACAGGCCATTGCGAAACTGGCTGAACACTACGGCATCATGTTCTTTTACCGGGGGCAGG
ACCCCATCGACGGGCAGCTGGCGCAGGTCATTAATGGCTTCAGGGATACCTATGGTCTGAGTGTTATTCC
CGTTTCCGTGGATGGCGTGATTAATCCGCTGTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAGCGC
CTCGGCGTGAAATATTTCCCGGCCATGATGCTGGTTGATCCGAAACAGGGCAGTGTTCGCCCGTTATCAT
ACGGTTTTATTTCGCAGGACGACCTGGCAAAACAGTTCCTGAACGTTTCTGAAGATTTTAAACCCAATTT
TTAA
 Primer design