SecReT4
Protein ID: 149930812
T4SS name [ID]Tra_F [121]
Gene symbol-
Locus tagSF0157_p96
StrainEscherichia coli plasmid pSFO157 (NC_009602)
Repliconplasmid pSFO157 [GenBank: NC_009602] [Browse all T4SS(s) in this replicon]
Location [Strand]120439..121185 [+]
Productconjugal transfer pilus acetylation protein TraX
Component typeTraX_F
UniProt IDQ0E810
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 3.3e-51, Aligned region: 32..247
Protein Sequence: 248 a.a.     [Download]
>gi|149930812|ref|YP_001294760.1| conjugal transfer pilus acetylation protein TraX [Escherichia coli]
MTTDNTNTTRNDSLAARTDTWLQSLLVWSPGQRDIIKTVALVLMVLDHANRILHLDQSWMFLVGRGAFPL
FALVWGLNLSRDAHIRQPAINRLWGWAVIAQFAYYVAGFPWYEGNILFAFAVAAQVLTWCETRSLWRTAA
AILLMALWGPLSGTSYGIAGLLMLAVSHRLYRAEDRTERLALVACLLAVIPALNLASSDAAAVAGLVMTV
LTVGLVSCAGKSLPRFWPGDFFLTFYACHLAVLGVLAL
 
Nucleotide Sequence: 747 bp     [Download]
>gi|149930749|ref|NC_009602.1|:120439-121185 Escherichia coli plasmid pSFO157, complete sequence
ATGACAACGGATAACACGAACACAACACGTAATGATTCACTGGCTGCCCGGACCGATACCTGGTTGCAGT
CGTTGCTGGTCTGGTCACCCGGACAGCGGGATATCATCAAAACGGTGGCACTGGTGCTGATGGTTCTGGA
CCATGCAAACCGCATTCTGCATCTGGACCAGTCGTGGATGTTTCTGGTCGGGCGTGGGGCCTTTCCGCTG
TTTGCGCTGGTCTGGGGACTGAATCTGTCCCGTGATGCGCATATCCGGCAACCGGCCATTAACCGGCTGT
GGGGATGGGCTGTGATTGCCCAGTTCGCGTATTACGTTGCCGGCTTTCCCTGGTATGAGGGGAATATCCT
GTTTGCCTTTGCAGTGGCGGCACAGGTGCTGACGTGGTGTGAGACGCGCAGCCTGTGGCGTACTGCCGCG
GCCATACTCCTGATGGCATTGTGGGGGCCTTTGTCCGGCACCAGTTACGGCATTGCCGGGCTGCTGATGC
TGGCGGTCAGTCACCGGCTGTACCGGGCGGAAGACAGAACGGAACGTCTGGCGCTGGTTGCATGCCTGCT
GGCCGTGATTCCGGCACTTAACCTTGCCTCCAGTGATGCGGCGGCTGTAGCTGGTCTTGTGATGACGGTG
CTGACCGTTGGTCTGGTGTCGTGTGCAGGGAAATCATTACCCCGTTTCTGGCCCGGGGATTTTTTCCTGA
CGTTCTATGCCTGTCATCTGGCTGTGCTGGGCGTTCTGGCGCTGTGA
 Primer design