SecReT4
Protein ID: 149930840
T4SS name [ID]Tra_F [121]
Gene symbol-
Locus tagSF0157_p72
StrainEscherichia coli plasmid pSFO157 (NC_009602)
Repliconplasmid pSFO157 [GenBank: NC_009602] [Browse all T4SS(s) in this replicon]
Location [Strand]90938..91249 [+]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDB7LI66, B7LWZ4, Q7B3W7
KEGG IDecz:pECS88_0067
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 4.3e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|149930840|ref|YP_001294736.1| conjugal transfer pilus assembly protein TraL [Escherichia coli]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGITTSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|149930749|ref|NC_009602.1|:90938-91249 Escherichia coli plasmid pSFO157, complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTATTGGCTGGGGTATCACAACATCGAAATA
TCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design