SecReT4
Protein ID: 150377483
T4SS name [ID]Trb [255]
Gene symbol-
Locus tagSmed_5376
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]342561..343538 [+]
Productconjugal transfer protein TrbB
Component typeTrbB
UniProt IDA6UKG5
KEGG IDsmd:Smed_5376
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.7e-89, Aligned region: 22..288
AAA_19 [PF13245], Evalue: 3.9e-05, Aligned region: 138..184
AAA_16 [PF13191], Evalue: 4.9e-05, Aligned region: 137..264
FtsK_SpoIIIE [PF01580], Evalue: 6.3e-05, Aligned region: 136..194
Protein Sequence: 325 a.a.     [Download]
>gi|150377483|ref|YP_001314078.1| conjugal transfer protein TrbB [Sinorhizobium medicae WSM419]
MTQLRSHPRLVRKLQEALGDQLCVALDDASVVEIMLNPDGKLFIDRLGDGVALAGEMSSAAAEIVVGTVA
HALQSEVDREQPIISGELPIGGHRFEGLLPPVVARPAFAIRRRASRLIPLEDYVRTGVMTEDQVSTIRSA
ISSRLNIIISGGTGSGKTTLANAVIDEIVKTRPDDRLVILEDTAEIQCAAQNAVLLHTSDKVDMARLLKS
TLRLRPDRIVVGEVRDGAALTLLKAWNTGHPGGAATIHSNTAMSALRRLEQLTAEVSQQPMHEVIGEAVD
LIVSIERTPRGRRVRDVIRVERFAGGEYEIESDQLTEEQEARHVA
 
Nucleotide Sequence: 978 bp     [Download]
>gi|150377168|ref|NC_009621.1|:342561-343538 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
GTGACCCAGCTTCGTTCTCACCCCCGACTCGTCCGCAAGCTTCAGGAGGCACTCGGCGATCAGCTCTGCG
TCGCCCTGGATGACGCGAGTGTCGTTGAGATCATGCTCAATCCAGACGGAAAGTTGTTCATCGACCGGTT
GGGCGACGGTGTTGCGCTTGCCGGGGAAATGTCATCAGCTGCTGCTGAAATTGTTGTCGGTACAGTGGCG
CATGCGCTCCAATCCGAGGTCGACAGGGAACAGCCGATCATCTCCGGTGAGTTGCCGATCGGTGGTCACC
GTTTCGAGGGGCTCCTTCCCCCGGTCGTGGCAAGGCCTGCCTTTGCGATTCGGCGCCGCGCCTCACGCCT
CATCCCCCTCGAAGACTATGTCCGCACCGGGGTGATGACCGAAGATCAAGTCTCGACTATCCGAAGTGCA
ATTTCCTCGAGGCTCAACATCATCATCTCCGGAGGGACCGGTTCCGGCAAGACGACGCTTGCAAATGCTG
TCATCGACGAGATCGTCAAAACCAGGCCGGATGATCGCCTCGTGATTCTTGAAGATACCGCGGAAATTCA
GTGCGCGGCCCAGAACGCCGTTCTTCTACATACCAGTGATAAGGTCGACATGGCGCGGCTCCTTAAGAGC
ACCCTGCGCTTGCGTCCCGACAGGATCGTCGTGGGCGAAGTGCGCGACGGCGCGGCCCTAACGCTACTCA
AGGCCTGGAACACCGGTCATCCCGGTGGGGCGGCTACGATTCACTCCAACACCGCCATGTCGGCGCTCCG
CCGTCTTGAACAGCTGACGGCCGAGGTAAGCCAGCAGCCAATGCACGAGGTTATTGGAGAAGCCGTCGAT
CTGATTGTTTCGATCGAGCGCACGCCCCGCGGGCGACGCGTTCGCGACGTCATCCGCGTCGAGCGTTTCG
CCGGCGGCGAGTATGAGATCGAATCCGATCAGCTCACGGAAGAACAGGAGGCGCGCCATGTTGCATAA
 Primer design