SecReT4
Protein ID: 150377484
T4SS name [ID]Trb [255]
Gene symbol-
Locus tagSmed_5377
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]343528..343908 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA6UKG6
KEGG IDsmd:Smed_5377
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.9e-19, Aligned region: 3..98
Protein Sequence: 126 a.a.     [Download]
>gi|150377484|ref|YP_001314079.1| conjugal transfer protein TrbC [Sinorhizobium medicae WSM419]
MLHKQALISVVAAASLLIAVVPALASSGGGGLPWEGPLEQIQESITGPVAGYIALAAVAIAGGMLIFGGE
LNDFARRLVYVVLVAGILLGATAIVGLFGATGASIGTPDEQIAKLGSNGGGEKAHV
 
Nucleotide Sequence: 381 bp     [Download]
>gi|150377168|ref|NC_009621.1|:343528-343908 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGTTGCATAAGCAAGCACTCATCAGCGTTGTTGCAGCCGCCAGCCTTCTCATAGCTGTGGTGCCGGCGC
TTGCGAGTTCAGGTGGGGGCGGTCTTCCGTGGGAAGGGCCGCTAGAGCAGATCCAGGAGTCGATCACGGG
CCCGGTCGCTGGATATATTGCCCTTGCGGCCGTCGCCATCGCTGGCGGAATGCTCATTTTCGGCGGCGAG
CTGAACGATTTCGCGCGGCGACTTGTGTACGTCGTTCTCGTGGCTGGCATCCTGCTCGGCGCCACTGCCA
TCGTTGGTCTGTTCGGCGCGACTGGCGCCTCGATCGGGACTCCAGACGAGCAGATCGCCAAGCTTGGGTC
GAACGGAGGAGGGGAGAAAGCTCATGTCTAA
 Primer design