SecReT4
Protein ID: 150377485
T4SS name [ID]Trb [255]
Gene symbol-
Locus tagSmed_5378
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]343901..344197 [+]
Productconjugal transfer protein TrbD
Component typeTrbD
UniProt IDA6UKG7
KEGG IDsmd:Smed_5378
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 2.2e-27, Aligned region: 8..91
Protein Sequence: 98 a.a.     [Download]
>gi|150377485|ref|YP_001314080.1| conjugal transfer protein TrbD [Sinorhizobium medicae WSM419]
MSNSLGLQRNRVHRALSRPNLLMGADRELVLITGLAAVILIFVVLTIYSALFGVAVWIVIVGFLRMMAKS
DPLMRQVYLRHISYKPYYGATSSPWRRS
 
Nucleotide Sequence: 297 bp     [Download]
>gi|150377168|ref|NC_009621.1|:343901-344197 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGTCTAATTCCCTCGGTCTGCAACGCAACCGCGTTCATCGCGCGCTTTCGCGCCCGAACCTCCTGATGG
GCGCGGACCGGGAGCTGGTTTTGATCACCGGGCTTGCGGCCGTGATCCTGATCTTCGTCGTGCTTACGAT
TTATTCGGCGCTCTTCGGTGTCGCAGTCTGGATCGTGATCGTGGGCTTTCTCAGGATGATGGCGAAGTCC
GATCCACTGATGCGACAGGTCTATTTACGGCACATTTCCTACAAACCCTACTATGGGGCGACTAGTTCGC
CGTGGCGCCGATCCTGA
 Primer design