SecReT4
Protein ID: 150377486
T4SS name [ID]Trb [255]
Gene symbol-
Locus tagSmed_5379
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]344208..346661 [+]
Productconjugal transfer protein TrbE
Component typeTrbE
UniProt IDA6UKG8
KEGG IDsmd:Smed_5379
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 7.6e-54, Aligned region: 190..400
AAA_10 [PF12846], Evalue: 4.5e-32, Aligned region: 457..729
Protein Sequence: 817 a.a.     [Download]
>gi|150377486|ref|YP_001314081.1| conjugal transfer protein TrbE [Sinorhizobium medicae WSM419]
MVALKRFRATGPSFADLVPYAGLVDNGVLLLKDGSLMAGWYFAGPDCESATDLERNELSRQINSVLSRLG
SGWMIQVEAIRIPTVDYPSDDHCHFPDPVTRAIDAERRAHFAHTQGHFESKHALILTYRPLESRKAALSK
YIYSDEESRKKSYADTVLFVFKNAVREIEQYFANTLSIKRMETRETVKRGGERVARYDELLQFVRFCITG
ESHPVRLPDIPMYLDWLATAELEHGLTPKVENRFLGVVAIDGLPAESWPGILNSLDLMPLTYRWSSRFIF
LDAEEARAKLERTRKKWQQKVRPFFDQLFQTQSRSVDQDAMLMVAETEDAIAQASSQLVAYGYYTPVVVL
FDDDRNTLQEKAESVRRLVQAEGFGARIETLNATDAYLGSLPGNWYCNIREPLINTSNLADLIPLNSVWS
GNAVAPCPYYPPNSPPLMQVASGSTPFRLNLHVDDVGHTLVFGPTGSGKSTLLALIAAQFRRYDRAQIFA
FDKGNSLLSLTLAAGGYHYDLCGDDAEERNALAFCPLSELKSDADRAWATEWIEMLIALQGVIITPDHRN
AISHQVSLMASATGRSLSDFVSGVQMREIKDALHHYTVDGPMGQLLDAEEDGLTLGALQTFEIEQLMNMG
ERNLVPVLTYIFRRIEKRLDGSPSLIILDEAWLMLGHPIFRSKIREWLKVLRKANCAVVLATQSISDAER
SGIIDVLKESCPTKICLPNGAAREPGTREFYERIGFNERQIEIVSIAIPKREYYVATPEGRRLFEMALGP
VALSFVGASGKEDLKRIRALKSEHGRDWPIHWLETRGVQDAAAILKK
 
Nucleotide Sequence: 2454 bp     [Download]
>gi|150377168|ref|NC_009621.1|:344208-346661 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGGTAGCCCTCAAACGTTTCCGTGCGACCGGTCCGTCCTTCGCCGATCTGGTCCCTTATGCCGGCCTGG
TCGATAATGGCGTTCTCCTCCTGAAGGACGGAAGCCTGATGGCCGGCTGGTACTTTGCTGGACCGGACTG
CGAAAGCGCCACTGACCTCGAACGCAATGAACTATCGAGGCAGATCAATTCGGTCCTGTCGCGCCTTGGA
AGTGGGTGGATGATTCAGGTCGAGGCGATCCGCATTCCGACAGTCGACTATCCATCTGACGACCACTGCC
ATTTCCCTGACCCGGTAACGCGTGCGATCGATGCCGAGCGCCGCGCGCACTTCGCACACACGCAGGGGCA
CTTCGAGAGCAAGCACGCGCTAATACTGACCTATAGACCGCTTGAGTCGAGGAAGGCTGCTCTTAGCAAA
TACATCTACTCGGATGAGGAGAGCCGCAAGAAGTCCTACGCGGACACGGTACTATTTGTCTTCAAGAACG
CCGTCCGCGAGATCGAGCAGTATTTCGCGAACACGCTTTCGATCAAGCGAATGGAAACGCGCGAAACGGT
TAAGAGGGGCGGGGAGCGGGTTGCCCGGTATGACGAGTTGCTCCAGTTCGTGCGGTTCTGCATAACAGGC
GAGAGTCACCCCGTCCGCTTGCCGGATATTCCGATGTATCTAGACTGGCTTGCGACCGCCGAGCTTGAAC
ACGGGCTGACGCCGAAGGTTGAGAACCGCTTCCTTGGCGTCGTTGCTATAGACGGCCTGCCGGCGGAAAG
CTGGCCAGGGATCCTGAACAGTCTTGACCTGATGCCGCTCACCTACCGATGGTCATCGCGCTTCATCTTT
CTCGATGCCGAAGAAGCCCGGGCGAAGCTCGAACGCACACGCAAGAAATGGCAGCAGAAGGTGCGGCCGT
TTTTCGACCAGCTGTTTCAGACGCAAAGCCGCTCGGTGGATCAGGACGCCATGCTGATGGTGGCCGAGAC
TGAGGATGCCATCGCCCAAGCCTCGTCGCAGCTGGTCGCCTATGGCTACTACACGCCTGTGGTCGTGCTG
TTCGATGACGATCGGAACACGCTGCAGGAGAAGGCCGAATCTGTGCGCCGACTGGTTCAGGCCGAAGGAT
TTGGTGCGAGAATTGAGACACTCAACGCGACCGACGCTTATCTCGGCAGCCTGCCGGGCAACTGGTACTG
CAACATCCGTGAACCGCTGATCAACACCAGTAACTTAGCTGATCTCATTCCTCTCAATTCGGTCTGGTCC
GGCAACGCCGTTGCACCATGCCCCTACTATCCGCCGAACTCGCCCCCACTGATGCAGGTCGCCAGCGGTT
CCACGCCATTTCGGCTGAACCTGCACGTCGATGATGTCGGCCATACGCTGGTCTTCGGCCCGACGGGGTC
AGGCAAATCTACGCTGCTGGCGCTGATAGCGGCGCAGTTTCGCCGTTATGACCGCGCCCAGATCTTTGCT
TTTGACAAAGGGAATTCGCTGCTTTCTCTAACGCTTGCAGCGGGTGGCTATCACTATGATCTCTGCGGCG
ACGATGCGGAAGAGAGGAACGCTCTGGCCTTCTGCCCTCTATCCGAACTGAAAAGTGACGCTGATCGGGC
GTGGGCGACGGAATGGATCGAGATGCTGATCGCCCTGCAGGGCGTCATCATCACCCCCGACCATCGCAAT
GCCATTTCCCATCAAGTCTCACTTATGGCCAGCGCGACGGGGCGCTCGCTGTCGGATTTCGTTAGCGGCG
TTCAGATGCGCGAGATTAAGGACGCACTTCATCACTACACCGTCGACGGTCCGATGGGCCAGTTACTTGA
TGCTGAAGAGGATGGGCTGACGCTTGGCGCCTTGCAAACTTTCGAAATCGAGCAGCTCATGAACATGGGT
GAGCGCAACCTGGTGCCTGTGCTCACCTATATCTTCCGCCGGATCGAGAAACGCCTCGATGGCTCGCCAA
GCCTGATCATTTTGGATGAAGCATGGCTCATGCTCGGCCATCCGATTTTCCGTAGCAAGATCCGCGAGTG
GCTGAAAGTGCTTCGCAAGGCGAATTGCGCCGTGGTGCTTGCTACGCAGTCGATCTCGGACGCTGAGCGC
TCCGGCATCATTGATGTGCTCAAGGAATCCTGCCCCACAAAGATCTGCCTTCCAAACGGCGCTGCTCGGG
AGCCGGGGACGCGCGAGTTCTACGAACGGATCGGCTTCAACGAAAGACAGATTGAGATCGTTTCGATCGC
CATTCCGAAGCGAGAGTACTACGTCGCCACTCCGGAAGGCCGACGGCTTTTCGAAATGGCTCTTGGTCCC
GTGGCACTCAGTTTCGTGGGGGCATCGGGGAAAGAGGATTTGAAGCGCATCCGCGCACTCAAATCCGAGC
ATGGCCGCGATTGGCCAATCCACTGGCTTGAAACGAGAGGAGTTCAAGATGCCGCAGCGATACTCAAAAA
ATAG
 Primer design