SecReT4
Protein ID: 150377487
T4SS name [ID]Trb [255]
Gene symbol-
Locus tagSmed_5380
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]346636..347436 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDA6UKG9
KEGG IDsmd:Smed_5380
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 266 a.a.     [Download]
>gi|150377487|ref|YP_001314082.1| conjugal transfer protein TrbJ [Sinorhizobium medicae WSM419]
MPQRYSKNSWFAGSMVASMTIVAALPVHAGTATGAATEWTQVLNNAELVSLVGQSGEQIQNQLTKISQLS
QQIETQLNIYRNLLQNTAALPSHMWGQVENDLNRLRSIVDQGQSIAFSMGNADDVLQQRFASYADLRTNL
PANETFSATYQTWSDTNRDTIASTLKAASLTADQFESEESAMSSLRSMSETADGQMKALQIGHQIAAQQV
AQMQKLRGLVSQQMTLMGTWLQTEQTDKDLAQARREKFFRAEVKSIPEGQKMEPRW
 
Nucleotide Sequence: 801 bp     [Download]
>gi|150377168|ref|NC_009621.1|:346636-347436 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGCCGCAGCGATACTCAAAAAATAGTTGGTTCGCTGGTTCCATGGTCGCTTCGATGACAATCGTCGCTG
CCCTGCCGGTTCACGCCGGCACGGCTACCGGTGCGGCAACGGAGTGGACGCAAGTACTCAACAACGCAGA
ACTGGTGTCCCTTGTAGGTCAATCTGGTGAGCAAATTCAGAACCAACTCACCAAGATTAGCCAGCTATCC
CAACAGATCGAAACACAGCTGAACATCTATCGGAATCTGCTGCAGAACACGGCCGCCCTGCCATCGCACA
TGTGGGGGCAGGTCGAGAACGATCTCAATCGGCTCCGTAGCATCGTCGACCAAGGGCAGAGCATAGCCTT
CTCGATGGGCAATGCTGACGATGTGCTGCAGCAGCGGTTTGCAAGCTATGCCGACCTAAGAACAAACCTG
CCGGCCAATGAGACGTTCTCCGCGACCTATCAAACCTGGTCGGACACCAACCGCGACACGATCGCCAGCA
CGTTAAAGGCGGCAAGTCTCACGGCCGATCAGTTCGAGAGCGAGGAAAGCGCAATGTCCTCCCTTCGGTC
AATGTCCGAAACGGCGGATGGCCAGATGAAGGCGCTGCAGATCGGACACCAGATCGCCGCTCAGCAGGTG
GCGCAGATGCAGAAGCTTCGCGGTCTCGTCTCACAACAGATGACGCTAATGGGAACCTGGCTACAGACCG
AGCAGACCGATAAGGATCTGGCTCAGGCGAGGCGGGAAAAGTTCTTCAGAGCCGAGGTGAAGAGTATTCC
GGAGGGGCAGAAGATGGAGCCCCGCTGGTGA
 Primer design