SecReT4
Protein ID: 150377489
T4SS name [ID]Trb [255]
Gene symbol-
Locus tagSmed_5382
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]347627..348835 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA6UKH1
KEGG IDsmd:Smed_5382
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1e-30, Aligned region: 61..273
Protein Sequence: 402 a.a.     [Download]
>gi|150377489|ref|YP_001314084.1| conjugal transfer protein TrbL [Sinorhizobium medicae WSM419]
MVKVTRPFLIAGLLCIAYSAPAFAQEGHVLTELENQVSSAAKGWETTIMNAARSLFWILAAIEIGIAAVW
LATQAASLDSWFAELVRRIMFVGFFAFILEQGPTFARAVVDSLFQIGADSDSASPAEVFDAGIRVASQMS
QQVQFGVFEDNALAIAAVLAMGVVVICFSLVAAIFVSVMVEMYVGLLAGMIMLGLGGSSFTKDFAVRYLI
YAFGVGMKLMALVMIAKIGSSVLLGLAQAPTASSDKFVTALAIAGISVVVFIIAMYVPTILQGVVQGASV
SGGMEAIRHGGQAASFAAGAGFLAAGAAGAGFEAGKFARAAGSSVAGAALRSVGAGIGSAGRAVGSAAKE
KAIGAPGAYAGSILGLANAKLDEQRSGLSESLPSATKSRNQEAKEDGSKPHA
 
Nucleotide Sequence: 1209 bp     [Download]
>gi|150377168|ref|NC_009621.1|:347627-348835 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGGTGAAGGTAACTCGTCCGTTCCTGATTGCCGGACTTTTATGCATAGCCTATTCAGCACCCGCTTTCG
CACAAGAGGGACACGTCCTCACGGAACTGGAAAACCAAGTCTCGTCCGCTGCGAAGGGGTGGGAGACCAC
CATTATGAATGCCGCACGATCCCTATTTTGGATTCTGGCGGCAATCGAGATTGGTATAGCGGCCGTCTGG
CTCGCCACTCAGGCCGCGTCGCTGGACAGCTGGTTCGCCGAGCTGGTGCGGCGTATTATGTTCGTCGGCT
TCTTCGCATTTATTCTGGAGCAAGGTCCAACTTTTGCGAGAGCCGTCGTCGACAGTCTTTTCCAGATTGG
TGCGGACAGCGATTCAGCTTCACCTGCTGAAGTATTCGACGCCGGTATCCGCGTAGCCTCGCAAATGTCG
CAACAGGTACAGTTTGGCGTCTTTGAGGATAATGCCTTGGCGATCGCGGCGGTATTGGCGATGGGCGTCG
TCGTCATTTGCTTCTCGCTTGTCGCAGCCATTTTCGTGTCGGTCATGGTCGAGATGTATGTTGGCCTCCT
CGCCGGTATGATCATGCTCGGACTGGGCGGCTCGTCCTTCACCAAGGACTTTGCTGTTCGGTACCTGATC
TATGCTTTCGGCGTCGGCATGAAGCTCATGGCCCTGGTGATGATCGCCAAGATAGGATCGAGCGTCCTGC
TTGGCCTCGCGCAAGCCCCCACCGCATCATCCGATAAATTCGTAACTGCCTTAGCGATCGCCGGTATTTC
CGTCGTGGTCTTCATCATCGCAATGTATGTGCCGACCATTCTTCAGGGTGTCGTCCAGGGCGCGTCCGTC
AGCGGAGGAATGGAAGCGATCCGCCATGGCGGACAGGCGGCATCGTTCGCCGCCGGTGCGGGCTTCCTCG
CCGCCGGTGCGGCCGGCGCTGGCTTTGAAGCGGGAAAGTTCGCACGAGCAGCGGGTTCATCCGTCGCAGG
TGCGGCTCTTCGAAGTGTGGGTGCCGGAATCGGGTCGGCAGGACGCGCTGTGGGGTCCGCTGCCAAGGAA
AAGGCAATCGGCGCTCCCGGTGCCTATGCCGGATCCATTCTCGGACTAGCCAACGCAAAGCTCGACGAGC
AACGCAGTGGGCTTAGCGAATCCCTCCCGAGCGCAACGAAATCCCGTAATCAGGAAGCGAAGGAAGATGG
CAGTAAACCGCACGCCTGA
 Primer design