SecReT4
Protein ID: 150377490
T4SS name [ID]Trb [255]
Gene symbol-
Locus tagSmed_5383
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]348813..349475 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDA6UKH2
KEGG IDsmd:Smed_5383
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.2e-45, Aligned region: 13..218
Protein Sequence: 220 a.a.     [Download]
>gi|150377490|ref|YP_001314085.1| conjugal transfer protein TrbF [Sinorhizobium medicae WSM419]
MAVNRTPENPYLAARQEWTERYGSYVKAAAAWRVVGILSLALALVGFSYALYLSTQVRLVPYIVEVDRLG
TSVASGFPEQIEYADARVVRATLGNFVTSFRSVTPDAVVQKQYIDRTYALLRTSDPSTQKINDWFRSNSP
FEKARSSTVAIEVNNIVALSNQTYQIDWTEYERDRKGKETGTRRFRGIATVALTAPQDEATIRLNPIGLY
VTDFDWTAQL
 
Nucleotide Sequence: 663 bp     [Download]
>gi|150377168|ref|NC_009621.1|:348813-349475 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGGCAGTAAACCGCACGCCTGAAAATCCCTATCTTGCCGCTCGCCAGGAATGGACCGAGCGATATGGCT
CCTATGTGAAGGCCGCAGCCGCATGGCGCGTTGTCGGCATACTCAGTCTTGCCTTGGCCCTCGTAGGTTT
CAGCTACGCTTTGTACCTCAGCACCCAGGTCAGGCTGGTGCCCTATATCGTGGAAGTCGATAGGCTTGGA
ACTTCGGTTGCGTCTGGCTTCCCCGAGCAGATCGAATATGCCGACGCCCGCGTAGTACGCGCCACTCTAG
GCAACTTCGTCACGAGCTTTCGCAGCGTCACCCCGGATGCCGTGGTGCAGAAGCAATACATCGACCGCAC
CTATGCGCTTCTACGCACCTCCGATCCGTCCACTCAAAAAATCAACGATTGGTTCCGAAGCAACTCCCCG
TTCGAGAAGGCCAGATCTTCAACAGTTGCCATCGAGGTCAACAATATTGTGGCCCTCTCGAACCAGACCT
ATCAGATCGACTGGACGGAATACGAGCGGGACCGGAAGGGCAAGGAAACCGGGACGCGCCGCTTTCGGGG
CATTGCAACGGTCGCGCTTACCGCACCGCAGGATGAGGCGACGATCCGTCTTAATCCGATCGGCCTCTAT
GTCACAGATTTCGACTGGACGGCGCAGCTATAA
 Primer design