SecReT4
Protein ID: 150377491
T4SS name [ID]Trb [255]
Gene symbol-
Locus tagSmed_5384
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]349492..350304 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDA6UKH3
KEGG IDsmd:Smed_5384
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.8e-55, Aligned region: 57..268
Protein Sequence: 270 a.a.     [Download]
>gi|150377491|ref|YP_001314086.1| conjugal transfer protein TrbG [Sinorhizobium medicae WSM419]
MQKTRLLTVAGCLAGLVFVSGAQAQNMTTNEVKGTKISSKWRGTPGLVTKGPDGKVIFLFGETQPSVVCS
PLQVCDIELQGGEIVRDVLVGDTVRWKVEPATSGATGGQAIHLVVKPSEPNLLTSMVVTTSRRTYHIQLK
SHPSQYMARIGFEYPEDVSTKLSDINARLEAGGIPGAAPDKLDFSYSISGQASWKPKRVYSDGVKTYIHF
PRSIFGQDAPVLFVVSGGQNRIVNYRMKNDMMIVDYAVDKAILVSGVGWRQQKIIIRRGS
 
Nucleotide Sequence: 813 bp     [Download]
>gi|150377168|ref|NC_009621.1|:349492-350304 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGCAAAAAACTCGATTGCTCACGGTCGCCGGCTGCCTAGCCGGACTCGTCTTTGTCAGTGGCGCGCAGG
CACAAAATATGACAACCAACGAGGTGAAGGGAACGAAGATTTCGAGCAAGTGGCGTGGCACGCCAGGGCT
GGTCACGAAAGGACCGGACGGAAAAGTGATTTTCCTGTTCGGGGAAACCCAGCCTTCTGTGGTTTGCTCG
CCCCTACAGGTCTGCGACATAGAGCTCCAAGGTGGGGAGATCGTTCGCGATGTTCTCGTCGGTGACACGG
TGCGCTGGAAGGTGGAGCCTGCGACTTCGGGAGCAACAGGGGGACAGGCGATTCATCTGGTCGTCAAACC
TTCGGAGCCCAACCTTCTCACCTCGATGGTGGTCACGACCTCCCGGCGAACCTATCACATCCAGCTCAAG
TCCCATCCCAGCCAGTACATGGCGCGCATTGGCTTCGAATATCCCGAAGACGTATCGACCAAGCTCTCGG
ACATCAATGCTCGCCTCGAGGCCGGCGGCATTCCAGGTGCCGCGCCCGACAAGCTAGACTTTTCCTATTC
AATCAGCGGCCAAGCGTCATGGAAGCCGAAGCGGGTCTATTCGGATGGGGTGAAGACATACATCCATTTT
CCAAGGTCGATTTTCGGTCAGGACGCGCCGGTCCTCTTCGTCGTTTCCGGCGGTCAAAATCGCATTGTCA
ACTATAGAATGAAGAACGACATGATGATCGTGGACTATGCAGTCGACAAGGCGATCCTCGTTTCCGGGGT
CGGTTGGAGGCAGCAGAAGATCATCATTCGGCGGGGAAGCTGA
 Primer design