SecReT4
Protein ID: 150377492
T4SS name [ID]Trb [255]
Gene symbol-
Locus tagSmed_5385
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]350308..350748 [+]
Productconjugal transfer protein TrbH
Component typeTrbH
UniProt IDA6UKH4
KEGG IDsmd:Smed_5385
PDB IDNA
Domain hit(s) vs Pfam TrbH [PF07283], Evalue: 3.4e-20, Aligned region: 36..141
Protein Sequence: 146 a.a.     [Download]
>gi|150377492|ref|YP_001314087.1| conjugal transfer protein TrbH [Sinorhizobium medicae WSM419]
MQNLLSTVIAAALLSGCQTADQGLRPSSDAGAVTGPAASAIAGDMVSRLAEQIGPATATTTIRMDKDTSE
FAIALEAALKGWGYTVVTDKKLVRGIKPVELAYAAESFDGQILARLSTPSIAFGRAYTPTGAGAMPASPL
SILQRN
 
Nucleotide Sequence: 441 bp     [Download]
>gi|150377168|ref|NC_009621.1|:350308-350748 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGCAGAATCTTCTTTCGACTGTGATTGCCGCCGCGCTTTTGTCTGGTTGTCAAACGGCGGATCAGGGCT
TGCGTCCCAGCTCAGATGCGGGAGCAGTCACCGGACCGGCCGCGAGCGCCATCGCCGGCGACATGGTGAG
CCGTCTTGCCGAGCAAATCGGCCCTGCCACAGCTACGACAACAATCAGAATGGACAAGGATACCTCCGAG
TTCGCGATAGCCCTCGAAGCAGCCTTAAAGGGGTGGGGCTACACGGTCGTCACCGACAAGAAATTGGTCA
GGGGCATCAAGCCCGTCGAGCTTGCATATGCAGCCGAGAGCTTCGACGGACAGATTCTGGCTCGACTCTC
GACGCCTTCCATTGCGTTCGGGCGAGCTTACACGCCGACTGGGGCCGGCGCCATGCCCGCTAGTCCGCTG
TCGATCTTGCAGCGCAACTGA
 Primer design