SecReT4
Protein ID: 150377493
T4SS name [ID]Trb [255]
Gene symbol-
Locus tagSmed_5386
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]350761..352053 [+]
Productconjugal transfer protein TrbI
Component typeTrbI
UniProt IDA6UKH5
KEGG IDsmd:Smed_5386
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 6e-62, Aligned region: 239..423
Protein Sequence: 430 a.a.     [Download]
>gi|150377493|ref|YP_001314088.1| conjugal transfer protein TrbI [Sinorhizobium medicae WSM419]
MVQSLQLGASSHADDQKAMRRLNRLPIFVAITVIVLFFAVVVIGLSWRGVSLKRGDDTQSISNTPATSFG
EQLKRGVTDGIIGEPVEREAFQPTPVVHKVDTQESVVERRPGERKERRPKLESEEEWKARLKREQDEQYI
REAHRQRMARLQAHATALDSPLKVDVSDIKNSTNHANTRQSRNLEAKGASDLHAAAMKSGLISQQVDPNG
QISKEEFFNKEIKDLGYLPNQVVPQLSPYELKRGSVIPATLITGLNSDLPGRIAAQVSQNVYDSATGYRL
LIPQGAKLLGRYDSKLSFGQERVLVVWTDLIFPNGSTLQIGGMAGTDAEGYGGFKDKVDRHLWRTFGSAA
LVAIIGTGIDMSLPESSTLATQDTASDAARRNFAESFGRVAEQTISKNLNVQPTIRIRPGYKFNILVDQD
IVFPSVYNGH
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|150377168|ref|NC_009621.1|:350761-352053 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGGTCCAGTCGCTTCAGCTCGGCGCGTCCAGTCATGCCGACGATCAGAAGGCCATGCGCCGCCTCAACC
GCCTGCCGATCTTCGTTGCCATCACTGTCATCGTGCTTTTTTTCGCCGTCGTTGTGATTGGCCTGTCGTG
GCGCGGGGTCTCCCTCAAGCGTGGCGACGACACCCAAAGCATCTCCAATACTCCGGCGACTAGCTTCGGC
GAGCAACTCAAACGGGGTGTAACGGACGGTATCATCGGAGAGCCAGTTGAACGCGAGGCTTTCCAGCCGA
CGCCAGTCGTTCACAAGGTCGACACGCAAGAATCCGTTGTTGAAAGAAGGCCTGGGGAACGAAAGGAGCG
ACGACCTAAGCTTGAATCCGAAGAGGAGTGGAAGGCTCGCCTGAAGCGAGAGCAGGATGAGCAGTATATA
CGCGAGGCCCATCGCCAACGAATGGCTCGCCTCCAAGCCCATGCGACCGCGCTCGATTCTCCGCTGAAGG
TGGACGTTTCCGATATCAAGAATTCAACAAATCACGCCAACACTCGTCAGTCTAGAAATCTCGAAGCGAA
GGGTGCCTCAGACCTACATGCAGCTGCTATGAAATCGGGCCTGATAAGCCAGCAAGTCGACCCGAACGGC
CAGATATCCAAGGAGGAGTTTTTTAATAAGGAAATCAAGGATCTTGGCTACCTGCCGAACCAGGTTGTAC
CGCAGTTGTCACCTTACGAATTGAAACGCGGCTCGGTTATTCCGGCCACATTGATCACTGGCCTCAATTC
CGATTTGCCAGGACGCATTGCTGCTCAGGTCAGCCAGAACGTCTATGACAGCGCTACCGGCTACAGACTG
CTCATTCCGCAGGGAGCCAAACTCCTGGGGCGCTATGATTCGAAGTTATCCTTCGGCCAAGAGCGGGTTC
TGGTCGTCTGGACCGATTTGATCTTTCCCAACGGTTCAACGCTGCAGATTGGCGGCATGGCCGGCACAGA
CGCCGAAGGATATGGCGGCTTCAAGGATAAGGTCGACCGTCATCTGTGGCGGACCTTCGGTTCCGCGGCT
CTAGTCGCAATAATCGGAACCGGTATCGATATGTCGTTGCCAGAGAGTTCAACGCTTGCAACGCAGGACA
CCGCCTCAGACGCTGCAAGGCGTAATTTCGCGGAAAGCTTTGGTCGGGTGGCGGAACAGACGATCTCAAA
GAACCTCAATGTGCAGCCGACGATCCGTATCCGTCCTGGCTACAAGTTCAATATTCTCGTTGATCAAGAT
ATTGTTTTTCCGTCGGTTTATAATGGCCATTGA
 Primer design