SecReT4
Protein ID: 150377498
T4SS name [ID]Trb [255]
Gene symbol-
Locus tagSmed_5392
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]355716..356282 [-]
Productconjugal transfer pilin processing protease TraF
Component typeTraF
UniProt IDA6UKI0
KEGG IDsmd:Smed_5392
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 6e-44, Aligned region: 41..185
Protein Sequence: 188 a.a.     [Download]
>gi|150377498|ref|YP_001314093.1| conjugal transfer pilin processing protease TraF [Sinorhizobium medicae WSM419]
MSIPLLQTAPTRRRRTPFLLGLAMAPLLFLGAISVASFGGYRINLTPSEPLGLWRFVKLDRPAAVGDLVL
VCPPQTAAMQEARRRGYLRAGLCPGDVAPLIKTVIAVAGQRVDVCVGVSVNGHPIPSSGLAQRDGQGRPM
TEFPGGIVPANYVFLHSRFASSYDSRYFGPVPASGILGLAQEVLTYAP
 
Nucleotide Sequence: 567 bp     [Download]
>gi|150377168|ref|NC_009621.1|:c356282-355716 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGAGCATTCCACTCCTTCAAACAGCGCCGACGAGACGACGCCGTACGCCATTCCTCCTTGGCTTGGCGA
TGGCCCCTTTACTTTTTCTTGGTGCAATCTCGGTCGCCTCGTTCGGTGGCTATCGCATCAATCTCACGCC
GAGCGAGCCGCTCGGTCTCTGGCGCTTTGTCAAACTGGATCGGCCAGCCGCCGTTGGCGATCTCGTCTTG
GTTTGCCCGCCTCAAACCGCGGCCATGCAAGAGGCGCGAAGGCGCGGTTACCTTCGCGCCGGGTTGTGTC
CTGGCGACGTCGCGCCGCTCATCAAGACAGTCATCGCCGTTGCGGGACAACGGGTCGACGTCTGCGTCGG
CGTCTCGGTGAACGGCCATCCGATTCCCTCCTCCGGTCTAGCGCAACGAGACGGACAGGGGCGACCTATG
ACCGAGTTCCCCGGCGGAATTGTGCCGGCAAACTACGTCTTCCTGCACTCGCGGTTCGCCAGCTCCTATG
ACTCTCGCTACTTCGGCCCCGTCCCGGCTTCCGGCATCCTCGGCCTGGCGCAAGAAGTCCTGACCTATGC
GCCGTAA
 Primer design