SecReT4
Protein ID: 150377502
T4SS name [ID]Trb [255]
Gene symbol-
Locus tagSmed_5396
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]360345..362264 [+]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDA6UKI4
KEGG IDsmd:Smed_5396
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1e-156, Aligned region: 163..633
TraG-D_C [PF12696], Evalue: 1.1e-33, Aligned region: 478..598
TrwB_AAD_bind [PF10412], Evalue: 1.9e-21, Aligned region: 302..611
AAA_10 [PF12846], Evalue: 2.5e-06, Aligned region: 226..559
Protein Sequence: 639 a.a.     [Download]
>gi|150377502|ref|YP_001314097.1| conjugal transfer coupling protein TraG [Sinorhizobium medicae WSM419]
MIANRIGLAVAPVVLMAFPVIGMTGFEQWLSALGKTDAARLTLGQAGIAVPYVSAAAIGVIFLFASAGSA
SIRFAGWGALTGSTATVLVAAIRETTRLAALAAEVPGGKSAASYIDPATMIGAAAVLMAGCFALRVAMIG
NAAFAPAEPKRVRGKRALHGQADWMRMHEASKLFPATGGVIIGERYRVDKDSTAAQPFRADDPETWGTGG
KSPLLCFDGSFGSSHGIVFAGSGGFKTTSVTVPTALKWGGALVVLDPSSEVAPMVCKHRRDAGRFIRILD
PKVPETGFNALDWLGRYGGTKEEDISSVASWIMSDSGGMRAVRDDFFRASALQLLTALIADVCLSGHTDR
ENQTLRQVRANLSEPEPKLRERLQSIYDNSGSDFVRENVAAFVNMTPETFSGVYANAVKETHWLSYPNYA
ALVSGSTFTTDAVAAGETDVFINIGLKTLETHSGLARVIIGSFLNALYNRDGAAQGRALFLLDEVARLGY
MRILETARDAGRKYGITLTMIYQSIGQMRETYGGRDAASKWFESASWISFAAINDPETAEYISKRCGMTT
VEIDQISRSSQSNGSSRTRSKQLAARPLIQAHEVLRMRADEQIVFTVGNAPLRCGRAIWFRRDDMKACVG
TNRFQGPLG
 
Nucleotide Sequence: 1920 bp     [Download]
>gi|150377168|ref|NC_009621.1|:360345-362264 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGATAGCGAATAGGATCGGCCTTGCAGTGGCTCCGGTCGTGCTTATGGCATTTCCTGTTATTGGAATGA
CCGGGTTTGAGCAATGGCTGTCAGCCTTAGGCAAGACGGATGCCGCAAGGCTGACCCTCGGCCAGGCCGG
TATCGCCGTGCCTTACGTCAGCGCCGCAGCGATCGGCGTAATTTTTCTATTCGCAAGCGCCGGTTCCGCG
AGCATCAGGTTCGCGGGGTGGGGCGCTCTAACCGGAAGCACGGCAACGGTTCTGGTCGCGGCGATACGCG
AGACGACACGTCTTGCCGCATTGGCCGCAGAGGTGCCTGGGGGCAAGTCCGCGGCCTCCTACATCGATCC
TGCAACGATGATCGGTGCGGCGGCGGTGCTGATGGCGGGTTGTTTCGCGCTTCGCGTCGCAATGATCGGC
AATGCAGCCTTCGCACCCGCCGAACCGAAACGGGTCCGTGGAAAACGCGCGCTGCATGGGCAGGCCGACT
GGATGAGAATGCACGAGGCGTCAAAGCTCTTTCCCGCTACGGGCGGTGTCATCATTGGCGAGCGTTACCG
AGTCGATAAGGACAGCACGGCAGCGCAGCCGTTTCGAGCTGATGATCCGGAGACCTGGGGCACCGGCGGC
AAGTCTCCGCTCCTGTGCTTCGATGGATCGTTCGGATCCTCGCATGGAATCGTGTTCGCCGGATCTGGCG
GCTTCAAGACAACGTCGGTGACAGTCCCAACTGCGCTCAAATGGGGTGGGGCGCTCGTCGTCCTCGACCC
CTCGAGCGAAGTGGCGCCGATGGTCTGTAAGCACCGCAGAGATGCAGGTCGTTTTATCCGTATCCTCGAC
CCCAAGGTACCGGAGACAGGCTTCAACGCACTCGACTGGCTTGGTCGCTACGGCGGGACGAAAGAGGAAG
ATATCTCTTCCGTCGCGTCGTGGATCATGAGTGACAGCGGCGGCATGCGCGCCGTGCGTGACGACTTCTT
CCGTGCATCGGCTTTGCAACTATTGACGGCGTTGATTGCCGACGTCTGCCTGTCCGGCCATACGGACAGG
GAGAACCAGACATTGCGGCAGGTTCGAGCCAATCTCTCGGAGCCGGAGCCAAAACTGCGAGAGCGGCTGC
AGTCAATCTACGACAATTCGGGCTCTGATTTCGTAAGGGAGAACGTCGCCGCATTCGTCAATATGACGCC
GGAAACCTTCTCGGGGGTTTATGCAAATGCCGTGAAGGAGACCCACTGGCTGTCCTACCCAAATTATGCC
GCACTCGTTTCGGGGTCCACCTTCACGACCGACGCAGTCGCAGCCGGCGAGACGGATGTGTTCATCAATA
TCGGCCTGAAGACGTTGGAGACGCATTCCGGCCTTGCGCGCGTCATCATCGGCTCGTTCCTTAACGCTCT
TTACAATCGCGATGGCGCGGCACAGGGCAGGGCACTTTTCCTCCTCGATGAGGTCGCGCGTTTAGGCTAC
ATGCGCATTCTCGAAACCGCGCGTGATGCCGGCCGCAAATACGGCATCACCCTCACGATGATTTACCAGT
CGATCGGCCAAATGCGCGAGACCTACGGTGGCCGTGATGCGGCGAGCAAATGGTTCGAGAGCGCGAGCTG
GATCTCTTTCGCTGCCATTAACGATCCGGAGACTGCTGAGTACATCTCGAAGCGCTGCGGCATGACGACC
GTCGAGATTGACCAGATCAGTCGCAGTTCCCAGTCGAACGGATCGTCGCGGACCCGTTCAAAGCAGCTTG
CTGCAAGACCACTGATTCAGGCGCATGAGGTGCTGCGAATGCGCGCCGACGAGCAGATCGTATTCACCGT
CGGGAATGCGCCGCTTCGATGCGGCCGCGCCATCTGGTTCCGACGCGACGACATGAAGGCATGCGTGGGA
ACGAATCGCTTTCAAGGACCCCTTGGATGA
 Primer design