SecReT4
Protein ID: 150378111
T4SS name [ID]VirB [17]
Gene symbol-
Locus tagSmed_6143
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]1070183..1071829 [+]
Producttype IV secretion system protein VirD4
Component typeVirD4
UniProt IDA6UM93
KEGG IDsmd:Smed_6143
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 4.6e-151, Aligned region: 82..522
TraG-D_C [PF12696], Evalue: 3.1e-28, Aligned region: 376..494
TrwB_AAD_bind [PF10412], Evalue: 1.6e-25, Aligned region: 120..507
AAA_10 [PF12846], Evalue: 9.5e-08, Aligned region: 125..449
Protein Sequence: 548 a.a.     [Download]
>gi|150378111|ref|YP_001314706.1| type IV secretion system protein VirD4 [Sinorhizobium medicae WSM419]
MCSLAVGYCGASAYSTFRFGFDGRALMTFDILAFWYETPFYLGYTTLFFYRGLAVVVLTSAAILLVQQMV
SVRDRQHHGTARWARVDEMRRAGYLQRYSRISGPVFGKTSGPFWSDYYLTNSEQPHSLIVAPTRAGKGVG
IVIPTLLTFEGSVIALDVKGELFDLTSRARKARGDSVFKLAPLDPERRTNCYNPLLDILALPSERQFTEA
RRLAANLIATKGQSAEGFINGARDLFVAGILACIERGTPTIGAVYDLFAQPGEKYSLFARLAQETQNKEA
QRIFDEMASNDTKILTSYTSVLGDGGLNLWADPLIKAATSRSDFSIYDLRRRRTCIYLCVSPNDLEVVAP
LMRLLFQQVVSILQRSLPGKDEKHEVLFLLDEFKHLGKLEAIETAITTIAGYKGRFMFIIQSLSALTGTY
DESGKQNFLSNTGVQVFMATADDETPVYISKAIGEYTFQARSTSYTQSLTFDRNIQHSDQGAPLLRPEQV
RLLPDKYQIVLIKGQPPLQLRKVRYYSDRALKRIFDSQTGRLPEPAPLMIADERFSHV
 
Nucleotide Sequence: 1647 bp     [Download]
>gi|150377168|ref|NC_009621.1|:1070183-1071829 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGTGTTCACTGGCAGTAGGTTATTGTGGGGCAAGCGCCTACTCAACGTTCCGTTTTGGTTTTGATGGAA
GGGCTTTGATGACATTTGACATCCTCGCTTTTTGGTATGAGACGCCTTTCTATCTGGGATACACAACTCT
CTTCTTCTATAGGGGTTTGGCTGTCGTCGTCTTAACGTCGGCAGCCATTCTGCTCGTTCAGCAGATGGTA
TCCGTGCGCGATCGGCAACATCACGGTACTGCACGCTGGGCTCGCGTGGATGAAATGCGGCGCGCGGGTT
ATCTTCAGCGGTACAGCCGCATCAGTGGACCGGTGTTCGGAAAGACGAGCGGGCCTTTTTGGTCTGACTA
CTACCTGACCAATAGCGAGCAGCCTCACAGCCTCATCGTTGCGCCGACGCGCGCGGGAAAAGGCGTCGGC
ATTGTAATTCCAACGCTACTAACGTTCGAGGGCTCAGTGATAGCCCTCGACGTTAAGGGCGAGCTCTTTG
ATCTCACTTCTAGGGCTCGCAAAGCGCGGGGCGATAGCGTGTTCAAATTGGCACCGCTAGACCCCGAGCG
GCGGACGAATTGCTATAATCCTCTATTGGATATCCTAGCATTGCCGTCAGAGCGGCAGTTCACCGAAGCG
CGTCGTTTGGCGGCAAACCTCATTGCGACCAAGGGACAGAGTGCGGAAGGTTTCATCAACGGCGCACGAG
ATCTTTTTGTCGCCGGCATTCTTGCCTGCATCGAGCGCGGTACGCCAACCATCGGGGCCGTCTACGACCT
CTTTGCTCAGCCAGGGGAGAAATATAGCCTTTTTGCGCGTCTTGCGCAGGAGACCCAGAATAAGGAGGCT
CAGCGGATCTTCGATGAAATGGCGAGTAATGATACAAAGATTCTGACCTCCTACACTTCTGTGCTCGGTG
ATGGCGGGCTGAACTTATGGGCCGACCCGCTGATTAAAGCGGCGACAAGCCGATCGGACTTCTCAATCTA
CGACCTGCGACGTCGCAGGACATGCATTTATCTTTGCGTCAGCCCAAACGATCTTGAGGTGGTCGCGCCT
CTGATGCGCCTGCTCTTCCAGCAGGTCGTTTCAATTCTGCAACGCTCGCTGCCCGGCAAGGACGAGAAGC
ACGAAGTGCTATTCCTGCTCGATGAATTCAAGCATCTTGGTAAGCTCGAGGCGATTGAGACTGCAATCAC
CACGATCGCGGGCTACAAGGGCCGTTTTATGTTCATTATCCAAAGTCTCTCGGCACTGACCGGAACATAC
GACGAATCTGGAAAGCAGAATTTCCTCAGCAATACTGGTGTGCAGGTCTTTATGGCAACAGCTGACGATG
AGACACCGGTTTATATTTCGAAAGCCATCGGTGAATATACATTCCAAGCGCGCTCAACTTCCTATACCCA
AAGCCTTACGTTCGATCGCAATATTCAACACTCAGATCAAGGAGCACCTTTATTAAGGCCAGAACAGGTG
CGTCTACTACCCGACAAGTACCAGATCGTTCTCATTAAGGGTCAGCCACCATTGCAACTACGAAAGGTAC
GATATTATTCCGATCGCGCACTGAAGCGCATCTTTGATAGCCAGACGGGCAGGCTTCCGGAGCCAGCACC
CCTGATGATTGCAGACGAGAGATTTAGCCACGTCTAG
 Primer design