SecReT4
Protein ID: 150378116
T4SS name [ID]VirB [17]
Gene symbol-
Locus tagSmed_6152
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]1077566..1078606 [-]
Producttype IV secretion system protein VirB11
Component typeVirB11
UniProt IDA6UM98
KEGG IDsmd:Smed_6152
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.4e-59, Aligned region: 15..312
Protein Sequence: 346 a.a.     [Download]
>gi|150378116|ref|YP_001314711.1| type IV secretion system protein VirB11 [Sinorhizobium medicae WSM419]
MQTEADPQLRLLLKPVLEWLEDPRTEEVAINRPGEAFVRQAGAFTKHPLSLTYDDLEDIAILAGALRKQD
VGPRSPLCATELPGGERLQICLPPAVQSGTVSLTIRRPSSRVSELKEVSSRYDASRWNQWRFRQERQTQQ
DMQILEHYARGNLEEFLQACVTGRLTMLLCGHTGSGKTTMSKTLINAIPPQERLITIEDTLELVIPHENH
VRLLYSKDGAGVGGVTAEQLLQASLRMRPDRILLGEMRDDAAWAYLSEVVSGHPGSISTIHGADAVQGFK
KLFSLVKSSPQGAAIEDRTLIDMLSAAIDVIVPFRTYGDVYEVGEIWLAADARRRGETVAGLLDQH
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|150377168|ref|NC_009621.1|:c1078606-1077566 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGCAAACCGAGGCAGATCCTCAACTGCGTTTGCTCCTCAAACCAGTACTAGAATGGCTTGAGGACCCAA
GGACCGAAGAGGTCGCGATTAATAGACCAGGAGAGGCTTTCGTCCGGCAAGCCGGAGCGTTTACGAAACA
TCCTCTATCTCTGACCTATGACGATCTCGAAGATATCGCGATCTTAGCGGGAGCGCTACGAAAGCAAGAT
GTTGGACCACGAAGCCCTCTCTGCGCCACCGAGTTGCCAGGCGGAGAGCGGCTGCAGATTTGTTTACCGC
CAGCAGTTCAGTCAGGTACCGTCAGCCTGACGATCCGCCGCCCATCTTCTCGCGTTTCGGAACTTAAGGA
AGTCTCATCTCGCTATGACGCTTCGCGCTGGAATCAATGGCGCTTCCGCCAGGAGCGCCAAACGCAACAG
GATATGCAGATCCTTGAGCATTACGCCCGCGGTAATTTGGAAGAATTCCTGCAAGCGTGCGTGACTGGGC
GGCTGACGATGCTGCTTTGCGGCCACACGGGTAGCGGCAAGACGACGATGAGCAAGACTTTGATTAACGC
CATTCCGCCGCAGGAAAGGCTGATCACCATAGAGGACACGCTCGAGCTCGTGATTCCACATGAGAATCAT
GTCCGGCTACTTTATTCGAAGGATGGGGCAGGAGTAGGTGGGGTGACCGCGGAGCAGCTTCTACAAGCCA
GTCTCCGCATGCGGCCGGACCGAATACTGCTCGGCGAGATGCGCGACGATGCCGCTTGGGCATATCTCAG
CGAAGTGGTATCTGGCCATCCAGGATCAATCTCGACTATTCACGGAGCCGATGCCGTCCAAGGTTTCAAG
AAGCTCTTTTCGCTCGTCAAGAGCAGCCCACAAGGAGCTGCCATAGAGGACCGTACGCTGATTGACATGC
TATCGGCGGCCATCGATGTCATCGTGCCGTTCCGGACCTACGGTGACGTCTACGAAGTTGGCGAGATTTG
GCTGGCGGCCGACGCGCGTCGACGCGGAGAAACAGTCGCTGGTCTTCTGGACCAGCATTAG
 Primer design