SecReT4
Protein ID: 150378117
T4SS name [ID]VirB [17]
Gene symbol-
Locus tagSmed_6153
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]1078646..1079764 [-]
Producttype IV secretion system protein VirB10
Component typeVirB10
UniProt IDA6UM99
KEGG IDsmd:Smed_6153
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.7e-61, Aligned region: 176..352
Protein Sequence: 372 a.a.     [Download]
>gi|150378117|ref|YP_001314712.1| type IV secretion system protein VirB10 [Sinorhizobium medicae WSM419]
MNDANPQTRHDVDADGSLVSESTRRRLSGPQKLMIASTIVASSLSLIWVSGSSKKEVEPTPPQTTVLTNT
EPFRPAPIEVAPVRSAPPSVGQPEAPPSAQSSSEPNDPRAEQSPIFAYESGEQDTGHAREDKEDDTSKQL
PSRLADEASVDNDLSTRMKAGVQEPSRATLLPHPDFTITQGTIIPCILQTAIDTSLPGYVRCLLPQDVRG
ATNNVVLLDRGTTVIGEIQRGLQQGDARVFVIWNRAETPHHAVVSLASPGADELGRSGMPGTVDNHFWQR
FAGAMLLSVVQGAFQAASQHTESSGGPNLNSFQSNGAQAADTALKTTINIPPTLQKNQGDAVSIFVARDL
DFSGIYELRMTTATTSARHRRP
 
Nucleotide Sequence: 1119 bp     [Download]
>gi|150377168|ref|NC_009621.1|:c1079764-1078646 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGAACGACGCCAATCCACAAACCAGGCACGACGTAGATGCAGACGGATCCCTGGTCTCTGAGTCAACTC
GCCGGCGTCTTTCAGGACCGCAGAAGTTGATGATTGCAAGCACTATTGTGGCATCATCACTATCCTTAAT
CTGGGTTAGCGGAAGTTCAAAGAAAGAAGTGGAACCTACTCCGCCTCAAACAACAGTTCTCACCAACACC
GAGCCCTTTCGTCCGGCACCAATTGAGGTTGCTCCCGTTCGTTCAGCTCCCCCGTCAGTTGGTCAGCCGG
AGGCTCCCCCGTCAGCACAGAGCTCCTCGGAACCAAATGATCCGCGGGCCGAGCAATCGCCAATTTTTGC
CTATGAAAGCGGTGAGCAAGACACCGGCCACGCACGCGAGGACAAAGAGGATGATACCTCGAAACAACTT
CCCTCGAGGCTCGCGGATGAAGCTTCAGTCGATAATGACTTATCGACGCGGATGAAAGCAGGCGTCCAGG
AGCCTAGCCGGGCCACACTCTTGCCGCACCCTGACTTCACGATCACGCAAGGAACAATCATTCCCTGCAT
TTTACAAACAGCGATCGATACAAGCTTGCCTGGCTATGTGAGGTGCCTTCTACCTCAAGACGTCCGCGGG
GCAACGAACAACGTTGTGCTTCTAGATCGCGGGACAACCGTCATTGGCGAAATTCAGCGGGGCCTTCAAC
AAGGCGACGCGCGCGTTTTTGTGATCTGGAATCGCGCCGAAACGCCGCATCATGCCGTAGTTTCGCTCGC
GTCACCAGGCGCTGACGAGCTCGGTCGCTCAGGTATGCCGGGCACGGTGGACAATCACTTCTGGCAACGT
TTCGCAGGGGCAATGCTCTTGAGCGTCGTTCAAGGTGCGTTCCAGGCCGCCAGTCAGCACACAGAAAGCT
CCGGCGGGCCTAACCTCAACAGCTTTCAAAGCAATGGGGCACAAGCCGCCGACACGGCGCTTAAAACGAC
GATCAACATCCCGCCAACCCTGCAGAAGAACCAGGGGGACGCAGTATCGATATTCGTGGCTCGAGATCTT
GATTTCTCAGGTATATACGAGCTTCGCATGACCACTGCGACAACGAGCGCGCGCCATCGCCGGCCCTAG
 Primer design