SecReT4
Protein ID: 150378118
T4SS name [ID]VirB [17]
Gene symbol-
Locus tagSmed_6154
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]1079761..1080642 [-]
Producttype IV secretion system protein VirB9
Component typeVirB9
UniProt IDA6UMA0
KEGG IDsmd:Smed_6154
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.7e-51, Aligned region: 31..265
Protein Sequence: 293 a.a.     [Download]
>gi|150378118|ref|YP_001314713.1| type IV secretion system protein VirB9 [Sinorhizobium medicae WSM419]
MITRTFLTIICLLCLAIAAHAEDTPAAGKLDPRMRYLAYNPDQVVRLSTAVGATLVVTFGASETVTAVAV
SNSKDLAALPRGHYLFFKASQALPPQPVVVLTASEAGTRRYVFSISTKTMSQLTKEQPDLYYSVQFVYPA
DEAAARQKQAEKLSIVGRLRADAEYQQRAQHLLDQPAAIADSGANNFHYIAQGDRSLTPLEVFDNGVSTV
FRFPGNVRIPSIYVINPDGKEATANYSVKGDYVEVPAVAREWRLRDGHTVLGIWNSAYDPIGRKPGTGTV
RHDVWRVLKGASR
 
Nucleotide Sequence: 882 bp     [Download]
>gi|150377168|ref|NC_009621.1|:c1080642-1079761 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGATAACAAGGACCTTCCTCACAATAATCTGTTTGCTTTGCTTAGCGATAGCCGCGCATGCGGAGGACA
CACCTGCGGCCGGCAAACTAGACCCGCGCATGCGGTATCTGGCCTACAATCCTGACCAAGTCGTCCGACT
ATCGACCGCTGTCGGGGCCACGTTGGTTGTTACATTCGGCGCCAGCGAGACCGTAACAGCCGTCGCCGTC
TCTAATAGCAAAGATCTGGCAGCCCTTCCGCGCGGCCACTATCTCTTTTTCAAGGCAAGCCAAGCCCTCC
CGCCGCAGCCAGTCGTCGTGCTGACCGCTAGCGAGGCAGGTACCCGACGATATGTCTTCAGCATCTCTAC
CAAGACCATGTCTCAGCTTACCAAAGAGCAGCCTGACCTCTATTATAGTGTGCAATTTGTCTATCCTGCC
GACGAAGCTGCTGCTCGGCAAAAACAAGCAGAAAAGTTGTCGATCGTCGGTCGGCTTCGGGCGGATGCGG
AGTATCAACAGAGGGCTCAGCATTTATTGGATCAGCCGGCCGCAATCGCGGATTCCGGAGCCAACAATTT
CCATTACATCGCACAGGGCGACCGTTCGCTTACGCCGTTGGAGGTTTTTGATAACGGAGTCAGTACTGTA
TTCCGCTTTCCAGGCAATGTGCGCATCCCGTCCATATACGTGATCAATCCGGACGGCAAGGAAGCCACCG
CCAATTATTCGGTCAAAGGAGACTATGTCGAGGTTCCCGCAGTTGCCCGTGAGTGGCGCCTGAGAGATGG
CCATACGGTATTAGGCATCTGGAATAGCGCATACGATCCCATTGGACGAAAGCCGGGCACCGGCACAGTG
AGACACGATGTGTGGCGCGTTCTGAAAGGGGCAAGTCGATGA
 Primer design