SecReT4
Protein ID: 150378119
T4SS name [ID]VirB [17]
Gene symbol-
Locus tagSmed_6155
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]1080639..1081352 [-]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDA6UMA1
KEGG IDsmd:Smed_6155
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.2e-45, Aligned region: 23..227
Protein Sequence: 237 a.a.     [Download]
>gi|150378119|ref|YP_001314714.1| type IV secretion system protein VirB8 [Sinorhizobium medicae WSM419]
MKSAEHALLVERGALAAHYIEVEAFQTSRAKSARRLSRVLVVIATAAVFGNIAQAFTIATMVPLAKLVPV
YLWVRPDGTVDSEVSVSRLPATQEQAVINASLWQYVRLREGYTADTAQYAYDLVSSFSAPSVRLEYQHHF
NYPNPTSPQVTIGEGGRLDVEHISSNDIATGVQQIRFNRTLMMDGQTPVMSTWTATVRYEKVTSLSGESR
LSNPGGLTVTSYQVSEDTVWNEGRSEQ
 
Nucleotide Sequence: 714 bp     [Download]
>gi|150377168|ref|NC_009621.1|:c1081352-1080639 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGAAGAGCGCTGAACATGCTCTCCTGGTGGAGCGAGGAGCGCTTGCCGCGCACTATATTGAAGTAGAGG
CCTTCCAAACGTCACGTGCGAAGTCGGCGCGGCGTCTTTCCAGGGTTCTGGTCGTCATTGCGACGGCGGC
TGTTTTTGGAAATATCGCGCAGGCCTTCACCATCGCGACTATGGTTCCGCTTGCCAAGCTCGTGCCTGTG
TATCTCTGGGTACGACCGGATGGAACCGTTGACAGCGAAGTGTCCGTGTCTCGACTTCCCGCAACGCAAG
AACAGGCCGTTATCAACGCTTCACTCTGGCAATATGTCCGTCTGCGCGAGGGGTATACAGCCGACACAGC
TCAATACGCCTATGATCTCGTATCGAGCTTCAGCGCACCATCTGTGCGCCTGGAATATCAGCATCACTTT
AATTACCCTAATCCGACGTCACCGCAGGTCACAATCGGTGAGGGGGGGAGACTAGATGTCGAGCACATCT
CCTCAAATGATATTGCGACGGGCGTGCAGCAGATTCGTTTCAACCGAACGCTCATGATGGATGGCCAGAC
GCCGGTGATGAGTACATGGACTGCAACGGTCCGGTATGAAAAGGTGACAAGCCTGTCCGGTGAATCGAGA
CTGTCCAACCCAGGGGGGTTGACTGTTACCTCCTACCAAGTCTCGGAAGACACCGTATGGAACGAGGGGC
GTAGCGAGCAATGA
 Primer design