SecReT4
Protein ID: 150378120
T4SS name [ID]VirB [17]
Gene symbol-
Locus tagSmed_6156
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]1081339..1081506 [-]
Producttype IV secretion system lipoprotein VirB7
Component typeVirB7
UniProt IDA6UMA2
KEGG IDsmd:Smed_6156
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 55 a.a.     [Download]
>gi|150378120|ref|YP_001314715.1| type IV secretion system lipoprotein VirB7 [Sinorhizobium medicae WSM419]
MKYCSLILFLALAACKTSDTLATCKGAAFQLNVERWQPTASDLQFECTGEPNEER
 
Nucleotide Sequence: 168 bp     [Download]
>gi|150377168|ref|NC_009621.1|:c1081506-1081339 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGAAGTATTGTTCTCTAATCCTATTCCTCGCTTTGGCCGCTTGCAAAACAAGTGATACCCTGGCGACCT
GCAAGGGTGCCGCGTTTCAGCTGAATGTGGAGCGTTGGCAACCCACGGCTTCAGATCTCCAGTTCGAATG
TACGGGAGAGCCAAATGAAGAGCGCTGA
 Primer design