SecReT4
Protein ID: 150378121
T4SS name [ID]VirB [17]
Gene symbol-
Locus tagSmed_6157
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]1081539..1082426 [-]
Producttype IV secretion system protein VirB6
Component typeVirB6
UniProt IDA6UMA3
KEGG IDsmd:Smed_6157
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.5e-31, Aligned region: 43..270
Protein Sequence: 295 a.a.     [Download]
>gi|150378121|ref|YP_001314716.1| type IV secretion system protein VirB6 [Sinorhizobium medicae WSM419]
MKFSVSAPFTTIHTVFDTAFTIALDSVLEKIQSAINAPLVACVTLWIIVQGILVIRGEIDARVGIMKIIR
VSIVVALILGQANYHSYVVLFFEDTIPNFVHKISGSSIALINIPQQLDLMFALSLSSFQKIAAEIGPMNS
QDILAFEGAQWVFYGALWVTFEVYDACGILTKVLLAIGPLILVGYLFDHTRDMASKWVGQLLSYGLLLLL
LNIVATIVITTEVVALKLMLIVINNAGTTAAKIIGLYELDMLFLAGDALIVALPVIAGNIAGAHWSGSNK
SLSSLSRQLAQVARR
 
Nucleotide Sequence: 888 bp     [Download]
>gi|150377168|ref|NC_009621.1|:c1082426-1081539 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGAAATTCTCAGTATCTGCGCCTTTTACGACTATACACACGGTCTTCGATACCGCCTTTACAATCGCAC
TGGACTCAGTGCTCGAAAAAATCCAGAGCGCAATCAATGCCCCTCTGGTTGCGTGCGTTACGCTTTGGAT
CATAGTCCAGGGCATTCTGGTGATACGTGGCGAAATCGATGCTCGTGTTGGGATCATGAAGATCATCAGA
GTATCGATCGTTGTAGCCCTTATCTTGGGCCAGGCTAACTATCACTCTTATGTAGTATTATTCTTCGAGG
ATACTATACCTAATTTCGTTCACAAAATCAGCGGTAGTAGTATTGCGCTGATTAATATCCCGCAACAGCT
CGACCTGATGTTTGCGTTAAGTCTGAGCTCGTTTCAGAAGATTGCGGCCGAAATAGGACCAATGAATAGC
CAAGACATTCTCGCCTTTGAAGGCGCACAGTGGGTTTTTTACGGTGCGCTTTGGGTAACGTTCGAGGTCT
ATGATGCCTGTGGGATTCTTACTAAGGTACTATTAGCGATCGGTCCGCTGATCCTGGTCGGCTATCTCTT
TGATCACACCCGCGACATGGCTTCAAAATGGGTCGGCCAGCTCCTCTCTTACGGGCTGCTGCTTCTCCTG
TTGAACATCGTGGCGACCATCGTCATAACAACGGAAGTAGTGGCTCTCAAACTAATGCTCATTGTGATCA
ACAATGCGGGCACGACGGCAGCCAAGATTATCGGGCTTTATGAACTCGACATGCTCTTTCTAGCTGGGGA
CGCCCTGATCGTCGCGCTTCCGGTGATCGCGGGCAATATTGCAGGTGCTCATTGGTCAGGCTCGAATAAA
TCTCTCAGCAGCCTTAGCCGCCAGTTGGCCCAAGTTGCGCGCCGTTGA
 Primer design