SecReT4
Protein ID: 150378122
T4SS name [ID]VirB [17]
Gene symbol-
Locus tagSmed_6158
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]1082508..1083191 [-]
Producttype IV secretion system protein VirB5
Component typeVirB5
UniProt IDA6UMA4
KEGG IDsmd:Smed_6158
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 1.4e-07, Aligned region: 7..52
Protein Sequence: 227 a.a.     [Download]
>gi|150378122|ref|YP_001314717.1| type IV secretion system protein VirB5 [Sinorhizobium medicae WSM419]
MKFTQLTVTTIAACLIMQAPARAQFVVTDPGNTYQAAITAGTTILNYAKTAQMLEQTIAMVGMFTTNFAV
TGLLSQINQGNKYPSTNKLSEQMFDSQRPVSATARAIATDRDRAIDGSDAHAELLRGQITGAANAASVAA
DNLELMDKRLRENGNTLGQLSRSRNIMQATVTNGLLLKQIHDAIIQNSQATSLLTMATAQASLHAAEEAA
AQRRERLETAKIFSPGL
 
Nucleotide Sequence: 684 bp     [Download]
>gi|150377168|ref|NC_009621.1|:c1083191-1082508 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGAAATTTACCCAACTGACAGTAACGACTATTGCCGCTTGCCTTATTATGCAGGCCCCGGCCCGAGCGC
AGTTCGTTGTCACCGACCCCGGAAATACATATCAGGCAGCGATCACTGCTGGTACCACTATTCTGAACTA
TGCGAAGACAGCACAGATGCTCGAACAGACGATTGCGATGGTGGGGATGTTTACAACGAACTTCGCAGTC
ACCGGCCTGTTGAGCCAAATCAACCAGGGGAATAAGTACCCCTCGACGAATAAGCTAAGCGAGCAGATGT
TTGACAGTCAGAGGCCAGTCTCGGCCACAGCACGCGCTATCGCAACGGACCGCGATCGCGCAATCGATGG
CAGCGACGCACATGCAGAGTTGCTCCGTGGGCAGATCACCGGTGCTGCTAATGCCGCGAGTGTTGCAGCC
GACAATCTCGAGTTGATGGACAAGCGCCTCCGCGAAAATGGCAACACGCTTGGTCAGCTGTCGCGTTCAA
GGAACATTATGCAGGCAACTGTAACAAACGGATTGCTTCTCAAACAGATTCACGACGCAATCATCCAGAA
CAGCCAGGCTACGAGTCTGCTGACGATGGCCACTGCACAGGCCAGCCTCCACGCTGCAGAGGAGGCCGCC
GCCCAGCGACGAGAACGCCTGGAAACCGCGAAAATCTTCAGCCCCGGACTATAG
 Primer design