SecReT4
Protein ID: 150378123
T4SS name [ID]VirB [17]
Gene symbol-
Locus tagSmed_6159
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]1083205..1085574 [-]
Producttype IV secretion system protein VirB4
Component typeVirB4
UniProt IDA6UMA5
KEGG IDsmd:Smed_6159
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 1.6e-62, Aligned region: 173..375
AAA_10 [PF12846], Evalue: 1.7e-24, Aligned region: 429..699
Protein Sequence: 789 a.a.     [Download]
>gi|150378123|ref|YP_001314718.1| type IV secretion system protein VirB4 [Sinorhizobium medicae WSM419]
MFGTNGRNERSGEIYLPYVGHLSDQVVLLEDGSVMAMAHVKGLPFEMEDVAIRNARCRAFNTLLRNIADD
SVSICAHLVRHNDVALPPARHFHSGFAGSLSEAYERRVLSGKLFRNDHFLTLVVFPRTAVGKITGRFIKR
NNRNENDLANQTRNLEDLWHITSGALDAYGLRRLGLREKDGVIFSEIAEALRLIMTCRATPVPVVSGSLG
ASIYTDRVICGKRALEIRTPGDSYVGSLFSFREYPAKTRPGMLNPLLSANFPLVLSQSFSFLTRAQAHAK
LSLKSSQMTSSGDKAVSQINELAEAEDALASSEFVMGAHHLSLCVYADDLNSLANRAASARTRLTDAGAV
IVQEGIGMEAAYWAQLPGNTKWRTRPGAITSRNFAGLVSFENFPSGKDSGHWGNSVARFRTNGGTPFDYL
PHENDVGMTAIFGPVGKGKTTLMTFVLAMLEQSMVGHDGAIVFFDKDRGGELLVRATGGTYLALRRGVPS
GLAPLRALDDTSASRDFLREWVTALIESDGRGAISPEENRRLERAIVRQLSFEPAMRSLAGLREFLLHSP
SEGAGARLERWCRGNALGWAFDGEVDEVRLHASITGFDMTQILEYEEVCAPAAAYLLHRVGAVVDGRRFV
MCCDEFRFYLLNPQFAAVVDKFLLTVRKNNGMLILATQQPEHVLESPLGASLVAQCMTKIFYPSPTADRS
AYVGGLKCTEGEYQAVREQMAIGSRKFLLKRESGSVICEFDLGEMREYVAVLSGRANTVRFADQLRARHG
DAPGAWVDEFMARYQEVQD
 
Nucleotide Sequence: 2370 bp     [Download]
>gi|150377168|ref|NC_009621.1|:c1085574-1083205 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGTTCGGCACAAATGGCAGGAACGAGAGGTCTGGTGAGATATATCTACCATATGTCGGCCACCTCAGCG
ATCAGGTTGTCCTTCTCGAAGACGGCTCAGTCATGGCTATGGCACACGTCAAAGGTTTGCCCTTCGAAAT
GGAAGACGTTGCCATCCGCAATGCACGCTGCCGAGCGTTCAATACGCTCTTACGCAACATTGCCGATGAT
AGTGTATCAATATGTGCTCATCTGGTCCGACATAACGACGTGGCGTTGCCCCCGGCGCGGCACTTTCATA
GCGGGTTTGCTGGTAGTCTGAGCGAAGCTTATGAGCGGCGTGTGCTGTCCGGAAAACTCTTTCGAAACGA
TCATTTCCTCACCTTGGTCGTGTTTCCCCGAACTGCGGTCGGTAAAATCACGGGCCGGTTCATCAAGCGG
AACAATAGAAACGAGAACGATTTAGCAAATCAGACGCGGAACCTGGAAGATCTGTGGCACATCACTAGTG
GCGCCCTCGACGCCTATGGTCTCCGCCGGCTTGGTCTCCGCGAGAAAGATGGCGTGATTTTCTCGGAAAT
CGCGGAGGCGCTCCGACTTATAATGACCTGCCGTGCCACTCCGGTTCCAGTGGTTAGTGGTTCACTGGGC
GCTTCGATTTATACCGACCGAGTAATCTGCGGCAAGCGGGCACTGGAGATTCGAACCCCGGGAGATAGCT
ACGTTGGCTCATTGTTCTCATTTCGAGAATATCCGGCAAAGACGCGGCCAGGCATGCTCAATCCGCTATT
GTCCGCGAATTTCCCGCTCGTGTTGAGCCAAAGTTTCTCCTTCCTCACGCGTGCACAGGCCCATGCCAAA
CTCAGCCTCAAGTCCAGTCAAATGACGAGTTCCGGTGACAAGGCCGTCTCCCAAATCAATGAACTCGCCG
AGGCAGAGGACGCGTTGGCAAGCAGCGAATTCGTAATGGGCGCGCATCATTTGAGCCTGTGCGTGTATGC
CGATGATCTCAATAGCCTTGCCAACCGCGCCGCAAGCGCCCGCACGCGATTGACGGATGCGGGCGCCGTT
ATCGTCCAAGAGGGTATTGGTATGGAGGCGGCTTATTGGGCGCAACTTCCGGGGAACACCAAGTGGCGCA
CGCGACCCGGGGCGATCACCTCACGCAATTTCGCGGGCCTTGTCTCGTTCGAGAATTTCCCAAGTGGCAA
GGATTCCGGCCACTGGGGCAACTCGGTTGCGCGCTTCCGCACCAATGGTGGAACCCCTTTCGACTACCTC
CCTCACGAGAATGACGTGGGTATGACGGCAATATTCGGACCCGTCGGAAAAGGCAAAACAACGCTCATGA
CCTTTGTCCTTGCGATGCTCGAACAGAGCATGGTTGGACACGATGGTGCGATTGTCTTCTTTGACAAGGA
CCGCGGTGGTGAACTGCTGGTACGTGCCACGGGAGGCACGTATCTGGCGTTACGTAGAGGCGTTCCCAGT
GGCCTGGCGCCTCTACGGGCCCTGGACGATACGTCGGCCTCCCGAGACTTTCTGCGCGAGTGGGTGACAG
CCTTGATCGAGAGCGATGGACGGGGAGCTATTTCGCCGGAAGAGAACCGCCGCCTGGAACGCGCCATCGT
CCGGCAGCTTTCATTTGAGCCCGCTATGCGTTCCCTCGCGGGCCTACGCGAATTCCTATTACACAGCCCG
TCCGAAGGCGCAGGAGCGCGACTGGAGCGGTGGTGCAGAGGAAACGCGCTCGGTTGGGCCTTCGATGGCG
AGGTGGATGAAGTAAGACTGCATGCCTCCATTACCGGCTTCGATATGACACAGATTCTGGAGTACGAAGA
GGTTTGCGCGCCGGCGGCCGCATACCTCCTCCATCGCGTGGGCGCTGTTGTGGATGGCCGTCGCTTTGTC
ATGTGTTGCGACGAGTTTCGATTTTATTTATTAAACCCTCAGTTCGCTGCAGTTGTAGACAAGTTCTTGC
TCACTGTTCGCAAGAATAACGGCATGTTGATACTCGCAACACAGCAGCCTGAGCATGTTCTCGAATCGCC
CCTCGGAGCCAGTCTCGTGGCACAATGCATGACAAAAATTTTCTATCCATCTCCGACGGCGGATCGATCA
GCCTATGTCGGCGGCTTAAAGTGTACCGAAGGAGAATATCAAGCCGTTCGCGAGCAGATGGCAATCGGGA
GCCGCAAATTTCTGCTTAAGCGCGAGAGCGGAAGCGTTATCTGCGAATTCGACCTCGGCGAGATGCGCGA
ATATGTCGCCGTGCTATCGGGTCGGGCCAACACGGTGCGTTTTGCCGATCAGCTCCGTGCCAGACACGGG
GATGCTCCTGGTGCGTGGGTAGACGAGTTCATGGCCCGTTACCAAGAAGTTCAAGACTGA
 Primer design