SecReT4
Protein ID: 150378124
T4SS name [ID]VirB [17]
Gene symbol-
Locus tagSmed_6160
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]1085574..1085900 [-]
Producttype IV secretion system protein VirB3
Component typeVirB3
UniProt IDA6UMA6
KEGG IDsmd:Smed_6160
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 1.9e-20, Aligned region: 1..89
Protein Sequence: 108 a.a.     [Download]
>gi|150378124|ref|YP_001314719.1| type IV secretion system protein VirB3 [Sinorhizobium medicae WSM419]
MSDRLEESTLYVAATRPALFLGVPLNLAALLMMLAGLIIVVVQNPLYEIILVPLWFGSRVVVERDYNAAS
VALLYLRTAGRSVDAPFWGGASVSPNPIKVPRRGRGML
 
Nucleotide Sequence: 327 bp     [Download]
>gi|150377168|ref|NC_009621.1|:c1085900-1085574 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGAGCGACCGACTGGAAGAGAGTACTCTCTACGTAGCAGCGACACGCCCTGCATTGTTCTTGGGCGTGC
CGCTGAACTTGGCGGCATTGCTCATGATGTTAGCCGGCCTGATCATCGTCGTTGTTCAGAACCCTCTTTA
CGAAATCATTCTTGTGCCACTGTGGTTCGGATCACGTGTTGTTGTCGAGCGCGACTACAACGCGGCCAGT
GTAGCCCTACTCTATCTCCGGACGGCTGGGAGAAGCGTGGATGCGCCGTTCTGGGGCGGGGCAAGCGTCA
GCCCCAATCCTATCAAAGTGCCGAGACGAGGACGAGGAATGCTTTAA
 Primer design