SecReT4
Protein ID: 150378125
T4SS name [ID]VirB [17]
Gene symbol-
Locus tagSmed_6161
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]1085897..1086259 [-]
Producttype IV secretion system pilin subunit VirB2
Component typeVirB2
UniProt IDA6UMA7
KEGG IDsmd:Smed_6161
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.6e-18, Aligned region: 26..115
Protein Sequence: 120 a.a.     [Download]
>gi|150378125|ref|YP_001314720.1| type IV secretion system pilin subunit VirB2 [Sinorhizobium medicae WSM419]
MASLNKHRARLSPVAFLKAMSRTAVDHAPAAGGAAVWSIVCSGPATAQVTGGTDPATMVNNICAFILGPF
GQSLAVLGIVAIGISWMFGRASLGLVAGVIGGIVIMFGASFLGKALIGAG
 
Nucleotide Sequence: 363 bp     [Download]
>gi|150377168|ref|NC_009621.1|:c1086259-1085897 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGGCGTCACTTAACAAACATCGTGCGCGTTTGAGTCCTGTTGCTTTCTTGAAAGCCATGTCGCGCACAG
CGGTTGACCATGCGCCCGCTGCCGGCGGAGCGGCGGTGTGGAGCATTGTCTGCTCCGGGCCAGCGACGGC
GCAAGTGACGGGGGGGACCGACCCTGCCACAATGGTGAATAATATCTGTGCATTCATCCTTGGTCCCTTC
GGACAGTCTCTGGCTGTGCTCGGCATCGTCGCCATCGGCATATCGTGGATGTTCGGCCGTGCTTCACTCG
GTCTCGTTGCCGGTGTCATCGGGGGGATCGTCATCATGTTCGGGGCCAGCTTCCTTGGTAAAGCCCTCAT
AGGGGCCGGATGA
 Primer design