SecReT4
Protein ID: 150378126
T4SS name [ID]VirB [17]
Gene symbol-
Locus tagSmed_6162
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED02 [GenBank: NC_009621] [Browse all T4SS(s) in this replicon]
Location [Strand]1086273..1086980 [-]
Producttype IV secretion system lytic transglycosylase VirB1
Component typeVirB1
UniProt IDA6UMA8
KEGG IDsmd:Smed_6162
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 8.7e-31, Aligned region: 33..173
Protein Sequence: 235 a.a.     [Download]
>gi|150378126|ref|YP_001314721.1| type IV secretion system lytic transglycosylase VirB1 [Sinorhizobium medicae WSM419]
MLNAALPLAVAILASMCVSSNAAPISLREFERLARGCAPQVNPSTLAAIAKVESGFDPLAAHDNTTGESL
HWNDQTQARQSVRARLEAQHSIDVGLMQINSKNFSVLNLTIEKAFQPCISLVAAAHLLESRYAGGDTAAE
KQLALRQAISAYNTGDLTRGFANGYVQKVESAAREIVPPLVGCPEKADEKPISEKIWDVWGSLEPDLSAG
DLISLPALQKPGDHEHLEKQHIIFD
 
Nucleotide Sequence: 708 bp     [Download]
>gi|150377168|ref|NC_009621.1|:c1086980-1086273 Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence
ATGTTAAACGCAGCTTTGCCCTTGGCTGTCGCCATCTTGGCCTCGATGTGCGTATCGAGCAACGCCGCGC
CAATCTCCTTGCGTGAGTTCGAGCGCCTTGCACGCGGATGCGCGCCGCAGGTAAATCCGTCTACGCTTGC
CGCAATCGCCAAGGTTGAAAGCGGCTTTGATCCGCTTGCGGCACATGACAACACCACCGGAGAGAGCCTT
CACTGGAACGATCAAACGCAAGCGCGCCAGAGCGTCAGAGCCCGCCTCGAGGCACAACATTCAATCGACG
TTGGGCTTATGCAGATCAACAGTAAGAACTTTTCCGTCCTCAATCTCACGATAGAAAAGGCCTTTCAGCC
CTGTATTTCACTTGTGGCCGCGGCGCACTTGCTTGAAAGCCGCTATGCCGGCGGCGACACTGCCGCAGAA
AAGCAGTTGGCGCTTCGCCAGGCAATCTCGGCCTACAACACGGGTGACCTGACGCGCGGATTTGCGAACG
GTTATGTGCAGAAGGTTGAGTCAGCCGCTCGAGAGATCGTGCCACCGCTGGTCGGATGTCCGGAAAAGGC
TGATGAAAAGCCGATCTCGGAAAAAATATGGGATGTGTGGGGTTCGTTAGAGCCAGACTTATCGGCAGGC
GATCTCATCAGCCTCCCCGCACTCCAGAAGCCTGGAGACCATGAACATCTCGAAAAACAACATATTATAT
TCGATTAA
 Primer design