SecReT4
Protein ID: 150378314
T4SS name [ID]VirB [471]
Gene symbol-
Locus tagSmed_6396
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED03 [GenBank: NC_009622] [Browse all T4SS(s) in this replicon]
Location [Strand]56661..58760 [-]
ProductTRAG family protein
Component typeVirD4
UniProt IDA6UMU5
KEGG IDsmd:Smed_6396
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 4.3e-94, Aligned region: 109..533
TrwB_AAD_bind [PF10412], Evalue: 1.3e-31, Aligned region: 127..517
TraG-D_C [PF12696], Evalue: 3e-30, Aligned region: 382..504
Protein Sequence: 699 a.a.     [Download]
>gi|150378314|ref|YP_001314908.1| TRAG family protein [Sinorhizobium medicae WSM419]
MTKQLQAFYLLFCVGIAFVVWMLGYGLGLQLFYRDGRILETTITSNPFAPIQQFWHYKTSPALQKVALGS
MLPALLAAGLVACIGLKPTSSPLGDAAFQDLASLRRRKWFRKQGHIFGRVGRNILRTKDDRHHLIIGPTR
SGKGAGYVIPNALMHEGSMIVTDLKGEVFKATAGYRRQNGSQVFLFAPGSEKTNSYNPLDFIRPERGNRT
TDIQNIASILVPENTESENSVWQATAQQVLAGVISYITESPFYKDRRNLAEVNSFFNSGVDLQALMKYIK
EKEPYLSKFTVESFNSYVALSERAAASALLDIQKAMRPFKNERIVAATNVTDMDLRAMKRRPISIYLAPN
ITDITLLRPLLTLFVQQVMNILTLEHDPNSLPVYFLLDEFRQLKRMDEIMTKLPYVAGYNIKLAFIIQDL
KNLDEIYGETSRHSLLGNCGYQLVLGANDQATAEYVSRALGKRTIRYQSESRTIELMGLPRRTKVEQIRE
RDLMMPQEVRQMPENKMILLIEGQRPIFGEKLRFFQTQPFKSAEAFSQANIPQVPEVDYLSPKPVPATTP
EYASGGDPSVEIPSPAPAKEEKPLTAAAAEAAPVMAEPAAGEKAAAPAKRAVNRKALRTNPKATAANTGG
AEASASLDAMEARIKAIEEGLKPKAAQLKEVVETKAEKLGGKSPTKRRNILDIFSATVPDPVEVGVTAE
 
Nucleotide Sequence: 2100 bp     [Download]
>gi|150378263|ref|NC_009622.1|:c58760-56661 Sinorhizobium medicae WSM419 plasmid pSMED03, complete sequence
ATGACGAAGCAGCTTCAGGCGTTCTACCTGCTCTTTTGCGTCGGGATAGCATTCGTTGTCTGGATGCTCG
GGTACGGCCTGGGGCTTCAGCTCTTCTATAGGGACGGTCGGATCCTCGAAACGACAATCACGAGCAATCC
TTTCGCTCCGATTCAACAGTTCTGGCATTACAAAACGAGCCCGGCCCTGCAGAAGGTCGCGCTTGGTTCG
ATGCTGCCGGCGCTGCTGGCGGCGGGCCTTGTCGCCTGCATCGGATTGAAGCCGACGAGCAGCCCATTGG
GGGATGCCGCGTTTCAGGACCTGGCTTCGCTACGGCGCAGGAAGTGGTTCCGCAAACAGGGACACATCTT
CGGCCGGGTCGGGCGGAACATACTCCGCACCAAGGACGATCGGCATCATCTGATCATAGGCCCGACGCGC
TCCGGTAAGGGTGCGGGCTATGTGATCCCCAATGCGCTGATGCATGAAGGCTCGATGATCGTTACCGATC
TCAAGGGCGAAGTGTTCAAGGCGACGGCGGGTTATCGCCGCCAGAACGGCAGCCAAGTCTTCCTATTCGC
GCCTGGCTCCGAAAAGACCAACAGCTATAACCCGCTGGACTTTATCCGGCCGGAGCGCGGCAATCGCACG
ACCGACATTCAAAACATCGCCAGCATTCTTGTGCCCGAGAACACAGAATCGGAAAATTCCGTCTGGCAAG
CGACCGCCCAACAGGTACTTGCAGGCGTGATCAGCTACATCACGGAAAGCCCCTTCTACAAAGACCGGCG
CAACCTCGCCGAGGTCAATTCCTTTTTTAACAGCGGCGTCGATCTCCAGGCGCTCATGAAATACATCAAG
GAAAAAGAGCCGTACCTTTCGAAGTTCACCGTCGAGAGCTTCAATTCCTACGTCGCCCTATCGGAACGCG
CGGCCGCGTCTGCTCTCTTGGACATTCAAAAGGCGATGCGGCCTTTCAAGAACGAGCGGATCGTTGCCGC
GACCAATGTCACCGACATGGATCTTCGCGCAATGAAGCGCCGGCCGATCTCGATCTACCTGGCGCCGAAC
ATCACCGACATCACCCTGCTGCGCCCTCTCCTCACCCTGTTTGTGCAGCAGGTGATGAATATCCTCACAC
TCGAGCACGATCCAAATTCCCTCCCCGTCTACTTCCTGCTCGACGAGTTCCGGCAGTTGAAGCGGATGGA
CGAGATCATGACCAAGCTGCCCTATGTGGCTGGCTATAACATCAAGCTCGCCTTCATCATTCAGGATCTG
AAGAACCTCGACGAGATCTACGGCGAAACCTCCCGGCATTCGCTGCTCGGCAATTGTGGGTATCAGCTCG
TCCTCGGTGCCAACGACCAGGCCACAGCCGAGTACGTATCCCGCGCGCTCGGAAAGCGCACGATCCGCTA
CCAGTCCGAATCTCGCACGATCGAACTGATGGGCCTGCCTCGCCGCACGAAGGTAGAGCAGATTCGCGAA
CGCGATCTGATGATGCCGCAGGAGGTCCGGCAAATGCCGGAGAACAAGATGATCCTGCTCATCGAAGGAC
AACGCCCGATCTTCGGTGAAAAGCTTCGCTTCTTCCAAACACAGCCCTTCAAATCAGCCGAGGCGTTTTC
TCAGGCCAACATTCCGCAAGTGCCGGAAGTCGATTATCTGTCACCGAAGCCCGTGCCGGCGACAACTCCG
GAATATGCCAGTGGCGGAGATCCTTCCGTCGAAATTCCCTCGCCGGCGCCAGCGAAGGAGGAGAAGCCTT
TGACGGCCGCCGCGGCGGAGGCAGCTCCGGTCATGGCAGAACCTGCGGCAGGCGAGAAAGCTGCAGCACC
TGCCAAACGCGCCGTCAATAGAAAGGCGCTGCGCACGAATCCTAAGGCGACTGCTGCAAACACTGGTGGT
GCGGAAGCATCTGCAAGCCTCGATGCAATGGAGGCCCGGATAAAGGCCATCGAGGAAGGCCTTAAGCCAA
AGGCCGCGCAGCTCAAGGAAGTGGTCGAGACGAAAGCTGAGAAGCTTGGCGGCAAGTCTCCGACCAAGCG
TCGCAACATCCTGGACATCTTCAGCGCGACCGTGCCTGACCCCGTCGAAGTCGGCGTGACGGCCGAATAG
 Primer design