SecReT4
Protein ID: 150378315
T4SS name [ID]VirB [471]
Gene symbol-
Locus tagSmed_6397
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED03 [GenBank: NC_009622] [Browse all T4SS(s) in this replicon]
Location [Strand]58757..59785 [-]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDA6UMU6
KEGG IDsmd:Smed_6397
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.1e-83, Aligned region: 23..326
Protein Sequence: 342 a.a.     [Download]
>gi|150378315|ref|YP_001314909.1| P-type DNA transfer ATPase VirB11 [Sinorhizobium medicae WSM419]
MNVAAGNTTTIRRDPHYFLNRALEPIREFLTDPRVVEIAVNKPGHVYVERFGAEYMEHHLIDALTGDEIQ
NIGERVAAATNQFISRSRPILSAALPTGERIQIVLPPAAPEGGSISIRKQVVNNFTLEEYRDNGSLDKVS
VAVGGLSDLDRELIEHLRANRIYDFVHTAITKRVSILISGGTSSGKTTFLNACLKSVDPHERIITLEDTR
ELFPPQANAVHLIASKGDQGTADVTIQSLLESSLRMRPDRLFVGEIRGAEAFSFLRAINTGHPGSMSTVH
ADTPMGAYEQLVMMMQQAGMSAGFSKQDLMSYIQMVIPIVIQLRREGGKRGVSEIFFARDEP
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|150378263|ref|NC_009622.1|:c59785-58757 Sinorhizobium medicae WSM419 plasmid pSMED03, complete sequence
GTGAACGTCGCCGCAGGTAACACCACTACGATCAGACGCGATCCCCATTATTTCCTCAACCGCGCTCTTG
AACCGATCAGAGAATTTCTTACCGATCCGAGGGTGGTGGAAATCGCCGTCAACAAACCGGGCCATGTCTA
TGTGGAACGGTTTGGCGCCGAATACATGGAGCATCATCTGATCGACGCCCTGACGGGTGATGAAATCCAG
AACATCGGCGAGCGTGTTGCGGCTGCTACGAACCAGTTCATCAGCCGCTCGAGGCCGATCCTCAGCGCCG
CGCTTCCGACTGGCGAGCGTATCCAGATCGTCTTGCCGCCGGCGGCACCCGAAGGGGGTTCGATCTCGAT
CCGCAAGCAGGTGGTCAATAACTTCACGCTCGAGGAGTATCGCGACAACGGTTCGCTCGATAAGGTCTCT
GTGGCCGTCGGCGGCCTCAGCGACCTTGATCGCGAGCTGATAGAGCATCTGCGCGCCAATCGGATCTATG
ATTTCGTCCATACCGCCATCACCAAGCGGGTCTCTATCCTGATCAGTGGCGGCACTTCCTCCGGCAAAAC
GACCTTCCTCAATGCCTGCCTGAAGAGCGTCGATCCGCATGAGCGGATCATCACGCTCGAGGACACGCGA
GAGCTCTTCCCACCGCAAGCAAATGCCGTTCATCTGATCGCGTCGAAGGGCGACCAGGGCACAGCGGACG
TGACCATTCAAAGCCTGCTCGAGTCATCGCTACGCATGCGGCCGGATCGCCTGTTCGTCGGTGAAATTCG
AGGCGCAGAGGCTTTTTCCTTCCTGCGGGCAATCAACACCGGCCATCCCGGCAGCATGTCGACGGTTCAC
GCCGATACGCCGATGGGCGCTTATGAACAGCTCGTCATGATGATGCAGCAAGCCGGCATGTCGGCGGGTT
TTTCGAAGCAGGATCTGATGTCGTATATCCAGATGGTCATCCCGATCGTCATCCAACTCCGCCGTGAAGG
CGGCAAGCGCGGGGTCTCTGAGATCTTCTTCGCCCGAGATGAGCCATGA
 Primer design