SecReT4
Protein ID: 150378318
T4SS name [ID]VirB [471]
Gene symbol-
Locus tagSmed_6400
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED03 [GenBank: NC_009622] [Browse all T4SS(s) in this replicon]
Location [Strand]61783..62478 [-]
ProductVirB8 family protein
Component typeVirB8
UniProt IDA6UMU9
KEGG IDsmd:Smed_6400
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.7e-65, Aligned region: 17..223
Protein Sequence: 231 a.a.     [Download]
>gi|150378318|ref|YP_001314912.1| VirB8 family protein [Sinorhizobium medicae WSM419]
MAETNDATLRSYFQDGDRWEQEIVKKAKRSRSLAWFVTMIFGAITLLSLTALVMLVPLKSFEPYIVEVDK
NTGYMEVKTSLTRSAKLTDQQAVTQANVVRYIRSREGYDPFAIEQNFGIAALLSTDDAARELQELYSAAN
PNNPAKVLGKNKKVTVDIKSVTFSNASTALVRFSTTEKSDTDSIVRHYISVVRYRYTDTPATNEWRFENP
LGFQVYNYRRDQETVTSGGEE
 
Nucleotide Sequence: 696 bp     [Download]
>gi|150378263|ref|NC_009622.1|:c62478-61783 Sinorhizobium medicae WSM419 plasmid pSMED03, complete sequence
ATGGCAGAAACGAATGACGCAACTCTTCGGAGCTACTTTCAGGACGGTGATCGCTGGGAACAGGAGATCG
TCAAAAAAGCCAAGCGATCGCGCTCGCTCGCATGGTTCGTCACAATGATTTTCGGCGCGATCACCCTGCT
GTCACTGACAGCATTGGTGATGCTCGTTCCGCTGAAGAGCTTTGAGCCGTACATCGTCGAGGTCGATAAA
AACACCGGCTATATGGAGGTGAAGACCAGCCTAACTAGGTCCGCCAAGCTGACCGACCAACAGGCGGTCA
CTCAAGCGAATGTCGTTCGCTATATCCGATCTCGCGAAGGCTACGACCCATTCGCGATTGAGCAGAATTT
CGGCATCGCCGCCCTGCTCTCTACTGATGATGCGGCCCGCGAGCTGCAGGAGCTTTACAGTGCGGCAAAT
CCCAACAATCCCGCAAAGGTCCTCGGCAAGAACAAGAAGGTAACCGTCGACATCAAGTCCGTCACCTTCT
CCAATGCGAGCACGGCCTTGGTCCGTTTTTCCACGACCGAAAAATCGGACACGGATTCGATCGTGCGTCA
CTACATTTCAGTCGTTCGCTATCGCTATACGGATACGCCGGCGACCAACGAATGGCGTTTTGAGAACCCC
TTGGGCTTCCAGGTCTACAACTACCGTCGCGATCAAGAAACGGTTACGTCGGGAGGCGAGGAATGA
 Primer design