SecReT4
Protein ID: 150378322
T4SS name [ID]VirB [471]
Gene symbol-
Locus tagSmed_6404
StrainSinorhizobium medicae WSM419
Repliconplasmid pSMED03 [GenBank: NC_009622] [Browse all T4SS(s) in this replicon]
Location [Strand]64478..65566 [-]
Productlytic transglycosylase catalytic
Component typeVirB1
UniProt IDA6UMV3
KEGG IDsmd:Smed_6404
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 362 a.a.     [Download]
>gi|150378322|ref|YP_001314916.1| lytic transglycosylase catalytic [Sinorhizobium medicae WSM419]
MRMSPALWVISALWLGASGTAHSQVPVLDGKVLETDTKRDQTTTEIEKTDSDRHTVSKSVTCSMYRPGRS
GDAASAATANPEITGLVKRVAQEEGVDESLFMALVYQESRFNPCAKSPVGAIGLSQLMPGTAKDLGVNPY
DMEDNLRGGARYLKQQLRRFNGNTNLALAAYNAGPGNVQKWGGIPPFKETQGYVANITQKWLPAFGGSDV
ANIPANYGGGSTAFTGMRDSTINSMATSQAIGESSGHVASWLQQLGAMSSGTIQDSWDHNSGARNANLEM
MNQVIRLGTTMADLMNSRSAVDIGNLSGASRTGDFKNDDDGADRETTGVCDPREGLEWSPTEKACVQKRE
REANVDLMLTAQ
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|150378263|ref|NC_009622.1|:c65566-64478 Sinorhizobium medicae WSM419 plasmid pSMED03, complete sequence
ATGAGGATGAGTCCTGCTTTGTGGGTGATTTCTGCGCTGTGGCTTGGTGCCTCCGGAACGGCGCACTCTC
AGGTGCCGGTGCTTGACGGCAAGGTGCTCGAGACCGACACCAAACGCGACCAGACGACGACGGAAATCGA
AAAGACGGATAGCGACCGTCATACGGTCAGCAAGAGCGTGACCTGCTCGATGTATCGTCCAGGTCGCAGC
GGTGACGCCGCTTCCGCTGCAACGGCCAACCCGGAAATCACCGGGCTTGTAAAGCGAGTGGCCCAGGAAG
AAGGCGTCGACGAAAGCCTCTTCATGGCGCTCGTCTATCAGGAAAGCCGGTTCAATCCGTGTGCGAAATC
GCCGGTCGGCGCCATTGGGCTTTCTCAGCTCATGCCGGGTACGGCAAAGGATCTGGGGGTCAATCCTTAT
GACATGGAAGACAATCTTCGTGGCGGCGCGCGCTATCTGAAGCAACAGCTCCGGCGCTTCAACGGCAACA
CCAATCTCGCTCTGGCCGCCTATAACGCGGGTCCTGGTAACGTCCAGAAGTGGGGCGGAATCCCACCTTT
CAAGGAAACGCAGGGGTATGTGGCGAATATCACCCAAAAGTGGCTTCCTGCTTTTGGCGGCTCCGACGTC
GCGAATATTCCTGCGAACTATGGCGGCGGTTCTACAGCCTTCACCGGCATGCGGGATTCCACCATCAACT
CAATGGCGACATCCCAAGCGATTGGGGAAAGCAGCGGACACGTTGCCTCTTGGCTGCAGCAGTTGGGCGC
AATGTCCAGCGGGACGATCCAAGACAGTTGGGATCACAATTCCGGCGCGCGAAATGCCAATCTCGAAATG
ATGAACCAGGTCATCCGCCTCGGCACGACGATGGCGGACCTTATGAATTCTCGTAGTGCGGTCGATATCG
GCAATCTTTCCGGCGCATCGCGCACGGGCGACTTCAAGAATGATGACGACGGCGCGGATCGCGAAACGAC
CGGTGTTTGCGATCCTCGCGAGGGGCTTGAATGGAGCCCGACAGAAAAGGCTTGCGTCCAGAAGCGGGAG
CGCGAAGCCAACGTAGATCTGATGTTGACCGCTCAATGA
 Primer design