SecReT4
Protein ID: 152973558
T4SS name [ID]Tra_F [112]
Gene symbol-
Locus tagKPN_pKPN3p06000
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN3 [GenBank: NC_009649] [Browse all T4SS(s) in this replicon]
Location [Strand]139855..140340 [-]
Productlytic transglycosylase-like protein
Component typeOrf169_F
UniProt IDA6TIF6
KEGG IDkpn:KPN_pKPN3p06000
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 161 a.a.     [Download]
>gi|152973558|ref|YP_001338609.1| lytic transglycosylase-like protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MKGAAFGIILSLIPLSSMAADCFDMAGRDYKIDPDLLRAISWQESRFKIDAIGRNPVTGYGSGLMQIDSQ
HFNELSRYGIKPDHLLSDACLNIYTGAYYLAQAFKKWGVSWDAVGAYNAGFKKTPRQAARRYEYAKKIHY
YYTAIKASKRTSSKDQKIAMN
 
Nucleotide Sequence: 486 bp     [Download]
>gi|152973416|ref|NC_009649.1|:c140340-139855 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence
ATGAAGGGAGCAGCGTTTGGTATCATCCTGTCTTTAATACCATTGTCATCAATGGCAGCAGACTGCTTTG
ATATGGCTGGCAGGGATTACAAAATTGATCCGGATCTCCTGCGTGCTATATCATGGCAAGAATCACGATT
TAAAATTGATGCGATTGGTCGTAATCCTGTTACGGGTTATGGATCAGGCTTGATGCAAATTGACTCGCAG
CATTTCAACGAACTGTCGCGATATGGAATAAAACCGGATCATCTTCTTAGCGATGCTTGTCTTAACATCT
ACACCGGAGCCTATTATCTGGCTCAGGCGTTTAAAAAGTGGGGCGTTTCGTGGGATGCAGTCGGGGCATA
CAATGCAGGCTTCAAAAAGACCCCGCGCCAGGCAGCAAGACGTTACGAGTATGCGAAGAAGATCCATTAC
TACTACACGGCTATCAAAGCAAGCAAACGAACTTCTTCTAAAGATCAGAAAATCGCCATGAACTAA
 Primer design