SecReT4
Protein ID: 152973559
T4SS name [ID]Tra_F [112]
Gene symboltraM
Locus tagKPN_pKPN3p06001
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN3 [GenBank: NC_009649] [Browse all T4SS(s) in this replicon]
Location [Strand]140768..141166 [+]
Productconjugal transfer protein TraM
Component typeTraM_F
UniProt IDA6TIF7
KEGG IDkpn:KPN_pKPN3p06001
PDB IDNA
Domain hit(s) vs Pfam Tra_M [PF05261], Evalue: 2.4e-61, Aligned region: 3..128
Protein Sequence: 132 a.a.     [Download]
>gi|152973559|ref|YP_001338610.1| conjugal transfer protein TraM [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MDMAKIQAYVSDEVAEKINAIVEKRKAEGAREKDVSFSSVSTMLVELGLRVYEAQMERKESGFNQMAFNK
VLLETVLKTQFATNKILGISCLSPHISGNQKFEWRFMIDTILEDTKEVVDTFFPESEDGEEE
 
Nucleotide Sequence: 399 bp     [Download]
>gi|152973416|ref|NC_009649.1|:140768-141166 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence
ATGGATATGGCAAAGATACAGGCATATGTTAGCGATGAAGTTGCTGAAAAAATTAATGCCATTGTGGAAA
AACGGAAAGCTGAGGGCGCCAGGGAGAAAGATGTTAGTTTTTCCAGTGTGTCTACGATGCTTGTCGAGTT
AGGCTTGAGGGTTTATGAAGCGCAAATGGAAAGGAAAGAAAGCGGCTTTAATCAGATGGCTTTCAATAAG
GTTTTGCTTGAAACAGTTTTGAAGACACAATTTGCAACCAACAAAATTTTGGGAATTTCTTGTTTGAGTC
CACATATCTCTGGCAACCAAAAATTTGAGTGGAGATTTATGATTGATACCATTCTGGAAGACACTAAAGA
AGTGGTCGATACATTCTTTCCAGAATCAGAAGATGGTGAAGAAGAGTAA
 Primer design