SecReT4
Protein ID: 152973561
T4SS name [ID]Tra_F [112]
Gene symboltraY
Locus tagKPN_pKPN3p06003
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN3 [GenBank: NC_009649] [Browse all T4SS(s) in this replicon]
Location [Strand]142159..142530 [+]
Productconjugal transfer protein TraY
Component typeTraY_F
UniProt IDA6TIF9
KEGG IDkpn:KPN_pKPN3p06003
PDB IDNA
Domain hit(s) vs Pfam TraY [PF05509], Evalue: 1.8e-41, Aligned region: 11..54
TraY [PF05509], Evalue: 1.8e-41, Aligned region: 67..114
Protein Sequence: 123 a.a.     [Download]
>gi|152973561|ref|YP_001338612.1| conjugal transfer protein TraY [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MTTRPALGPCVSFKLDEDTHLKLVNAKERSGRSKAGEVVLRVKDHLLRYPDFYPTVTYKSVSFGPVVMAR
FDEDTNKKLIAAKNKSNRSKSHEVYLRLKAHLFEFPDFYSSEVEVIRRSVSET
 
Nucleotide Sequence: 372 bp     [Download]
>gi|152973416|ref|NC_009649.1|:142159-142530 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence
ATGACTACTCGTCCGGCATTAGGTCCATGCGTAAGTTTTAAACTTGATGAAGATACGCATCTGAAATTGG
TAAACGCCAAAGAGAGAAGCGGACGTAGTAAGGCTGGGGAGGTTGTGCTTAGGGTTAAGGATCACCTTTT
ACGCTATCCAGATTTTTATCCAACTGTAACTTATAAGAGTGTGAGTTTTGGTCCTGTTGTTATGGCCCGC
TTTGATGAGGATACAAACAAAAAACTGATTGCAGCTAAAAATAAAAGTAACAGAAGCAAGTCGCATGAAG
TTTATCTTCGTCTCAAAGCGCATCTGTTCGAATTTCCTGATTTTTATAGCTCTGAAGTCGAAGTGATAAG
GAGGTCTGTATCTGAAACATAA
 Primer design