SecReT4
Protein ID: 152973562
T4SS name [ID]Tra_F [112]
Gene symboltraA
Locus tagKPN_pKPN3p06004
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN3 [GenBank: NC_009649] [Browse all T4SS(s) in this replicon]
Location [Strand]142644..142952 [+]
Productconjugal transfer pilin subunit TraA
Component typeTraA_F
UniProt IDA6TIG0
KEGG IDkpn:KPN_pKPN3p06004
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 3.2e-30, Aligned region: 6..100
Protein Sequence: 102 a.a.     [Download]
>gi|152973562|ref|YP_001338613.1| conjugal transfer pilin subunit TraA [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MSRVFNKKKALKAAKVALPVAAVAAFFPDAAMATTTATDLMKSGDATVKGTFGKQSSVVKWVVLAEVVAG
GIMYMMTKNVKFLFGFAIISTFITIGMSVAGY
 
Nucleotide Sequence: 309 bp     [Download]
>gi|152973416|ref|NC_009649.1|:142644-142952 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence
ATGTCCCGCGTTTTCAATAAAAAGAAAGCCCTGAAAGCCGCTAAAGTTGCGCTGCCGGTTGCTGCTGTGG
CGGCGTTCTTCCCGGATGCTGCGATGGCCACCACCACGGCAACCGACCTGATGAAGTCCGGGGATGCGAC
CGTTAAAGGCACGTTTGGTAAGCAGTCCAGCGTCGTCAAATGGGTGGTTCTGGCAGAAGTTGTCGCCGGC
GGCATCATGTACATGATGACCAAAAACGTGAAGTTCCTGTTTGGCTTCGCGATTATTTCCACCTTTATCA
CCATCGGTATGTCGGTCGCCGGTTACTGA
 Primer design