SecReT4
Protein ID: 152973563
T4SS name [ID]Tra_F [112]
Gene symboltraL
Locus tagKPN_pKPN3p06005
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN3 [GenBank: NC_009649] [Browse all T4SS(s) in this replicon]
Location [Strand]142966..143271 [+]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDA6TIG1
KEGG IDkpn:KPN_pKPN3p06005
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 5.5e-39, Aligned region: 8..101
Protein Sequence: 101 a.a.     [Download]
>gi|152973563|ref|YP_001338614.1| conjugal transfer pilus assembly protein TraL [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MTGDELKRYRFPETLTNQSRWFGLYLDELIPAVICLGWGFWTSKFIFGMAAAALVFWGIKKLKKGRGSSW
LRDLIYWYLPTSLLKGFFHDVPDSCFRQWIK
 
Nucleotide Sequence: 306 bp     [Download]
>gi|152973416|ref|NC_009649.1|:142966-143271 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence
ATGACGGGAGACGAATTAAAGCGATACCGTTTCCCGGAAACACTGACTAACCAGTCCCGCTGGTTTGGCT
TATATCTCGATGAACTTATCCCGGCCGTGATTTGTCTCGGCTGGGGTTTCTGGACCAGCAAGTTCATTTT
TGGTATGGCTGCAGCGGCACTGGTTTTCTGGGGTATCAAGAAACTGAAAAAAGGGCGGGGCAGTTCCTGG
CTACGCGACCTGATTTACTGGTATCTGCCAACCTCCCTTCTTAAAGGTTTCTTTCATGATGTTCCGGACT
CCTGTTTCCGGCAGTGGATTAAATAA
 Primer design