SecReT4
Protein ID: 152973564
T4SS name [ID]Tra_F [112]
Gene symboltraE
Locus tagKPN_pKPN3p06006
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN3 [GenBank: NC_009649] [Browse all T4SS(s) in this replicon]
Location [Strand]143291..143857 [+]
Productconjugal transfer pilus assembly protein TraE
Component typeTraE_F
UniProt IDA6TIG2
KEGG IDkpn:KPN_pKPN3p06006
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 6e-75, Aligned region: 1..187
Protein Sequence: 188 a.a.     [Download]
>gi|152973564|ref|YP_001338615.1| conjugal transfer pilus assembly protein TraE [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MEHGARQNTTRVIAVGFISLGTLLTLSLATNIIQGINNYRLQTEQKVAVTPMLFRAPFAVSQNQADASYI
EQLGLSFVALRLNVTPETVDAQHQQLLRYVLPAAQNSLKVQLAEDAKRIKDNNVNATFYMTSIRAWPAEN
RVDIRGELKTWIGDSKPYSEIKSYVIQFSRVDGVSWLARFGEINNEKN
 
Nucleotide Sequence: 567 bp     [Download]
>gi|152973416|ref|NC_009649.1|:143291-143857 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence
ATGGAACATGGTGCCAGACAAAATACCACCCGCGTTATCGCTGTGGGATTTATCAGTCTGGGGACACTCC
TGACCCTCAGTCTTGCGACCAATATTATCCAGGGCATAAATAATTACCGTCTGCAGACGGAACAGAAAGT
GGCGGTGACACCGATGTTATTCCGAGCCCCCTTTGCGGTGTCTCAGAACCAGGCTGACGCCTCTTATATT
GAGCAGCTGGGCCTGTCCTTTGTTGCCCTGCGTCTGAATGTCACGCCGGAAACGGTTGATGCCCAGCATC
AGCAGCTTCTCCGGTATGTATTACCCGCTGCGCAGAACAGCCTAAAGGTCCAGCTGGCTGAAGATGCGAA
ACGCATTAAAGACAATAACGTTAATGCCACCTTTTATATGACCTCGATCCGTGCGTGGCCGGCAGAGAAC
CGCGTGGATATCCGGGGTGAGCTGAAAACGTGGATTGGGGATTCCAAACCCTACAGTGAAATTAAAAGTT
ATGTCATTCAGTTCAGTCGTGTCGATGGTGTCAGCTGGCTGGCGCGTTTTGGAGAAATAAATAATGAAAA
AAATTAA
 Primer design