SecReT4
Protein ID: 152973565
T4SS name [ID]Tra_F [112]
Gene symboltraK
Locus tagKPN_pKPN3p06007
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN3 [GenBank: NC_009649] [Browse all T4SS(s) in this replicon]
Location [Strand]143844..144584 [+]
Productconjugal transfer protein TraK
Component typeTraK_F
UniProt IDA6TIG3
KEGG IDkpn:KPN_pKPN3p06007
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 7.2e-72, Aligned region: 11..237
Protein Sequence: 246 a.a.     [Download]
>gi|152973565|ref|YP_001338616.1| conjugal transfer protein TraK [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MKKINPLFISGCLLLVAPAMSATLSGTLAPTVVPLTNGGQANIAVSNTDPNLFTVPGDRITAINSLDGGL
TNQEQTDSGGAILATVSKKPFTFIVETERGLNFSIRAVPRAGSGRTIQLVSELAGTPGPAKAWEESNPYE
SLLVSLNRAVRQGSVPDEYQSVPVTSEVLQVPAGLRATADRVWVGHHLKVVRYSLDNVSLSARMVRESDF
WQPGTRAVMFSTPAGLLTAGGRMQIWVTTSDEGVER
 
Nucleotide Sequence: 741 bp     [Download]
>gi|152973416|ref|NC_009649.1|:143844-144584 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence
ATGAAAAAAATTAACCCGTTATTTATTTCAGGCTGTCTGCTGTTGGTCGCCCCCGCGATGTCAGCGACCC
TTAGCGGAACGCTGGCGCCGACAGTGGTTCCCCTGACCAATGGCGGTCAGGCAAATATTGCCGTGAGTAA
CACCGATCCGAATCTGTTCACAGTACCTGGAGATCGCATCACGGCGATAAACAGCCTGGACGGCGGTCTG
ACAAACCAGGAGCAGACCGACAGCGGCGGCGCCATTCTGGCGACCGTCAGTAAAAAACCATTCACCTTCA
TTGTGGAAACCGAACGCGGACTGAACTTCTCCATTCGTGCCGTGCCCCGTGCGGGCTCAGGCCGGACAAT
TCAGCTGGTCAGCGAGCTGGCAGGGACACCCGGTCCGGCAAAAGCCTGGGAGGAGTCGAACCCCTATGAA
TCGTTACTGGTTTCGCTGAATCGCGCCGTGCGCCAGGGCAGCGTACCCGATGAGTATCAGTCTGTCCCCG
TCACTTCTGAAGTGCTGCAGGTGCCGGCTGGTCTGCGCGCCACTGCCGATCGGGTCTGGGTCGGTCATCA
CCTGAAAGTTGTCCGTTACAGTCTGGACAATGTCTCCCTGTCGGCCCGTATGGTTCGTGAAAGCGATTTC
TGGCAGCCCGGAACACGTGCCGTCATGTTCAGTACCCCGGCAGGCCTGCTGACTGCCGGTGGTCGCATGC
AGATCTGGGTCACGACGTCAGATGAAGGAGTGGAGCGCTGA
 Primer design