SecReT4
Protein ID: 152973566
T4SS name [ID]Tra_F [112]
Gene symboltraB
Locus tagKPN_pKPN3p06008
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN3 [GenBank: NC_009649] [Browse all T4SS(s) in this replicon]
Location [Strand]144584..146008 [+]
Productconjugal transfer pilus assembly protein TraB
Component typeTraB_F
UniProt IDA6TIG4
KEGG IDkpn:KPN_pKPN3p06008
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.5e-38, Aligned region: 209..405
Protein Sequence: 474 a.a.     [Download]
>gi|152973566|ref|YP_001338617.1| conjugal transfer pilus assembly protein TraB [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MANFNTLIKRKQYIWLGLILAGGAAAVGGGLYLSDLNMSSDEEAPAQGEPAPDMTGVVDSSFNSKVEQHA
TTEMQATAADLNKRFDSLQGEVDLLSKARSADQIRIDKLSSDNEAMQNQLKALGVKPAVSGGEPAPTPPS
PPPGPEGEPQPASYPPQTGAAVPPPTAFYPGNGMTPPPQVSYQSVPVPNQIQRKTFSYDKGKKAKSLPYI
PSGSFAKSMLIEGADANASVTGNESTVPMQLRITGRVEMPNSKTYDLTGCFVGLEAWGDVSSERAIVRTR
NISCIKGDKTIDQPINGHVSFMGKNGVKGEVVMRNGKILGWAWGAGFVDGIGQGMERASQPAVGLGATAS
VGAGDVLKMGVGGGASKAAQTLSEYYIKRAEQYHPVIPIGAGNEVTVVFQDGFQLKTIEELEAEKNGQQQ
AQNQEAEPAPQADAHHQSGGGMNGFNTDEMLKKLGKLDPREFSPGAAPQGENNG
 
Nucleotide Sequence: 1425 bp     [Download]
>gi|152973416|ref|NC_009649.1|:144584-146008 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence
ATGGCCAACTTCAACACGCTGATCAAACGTAAGCAATATATCTGGCTGGGACTCATTCTGGCGGGCGGCG
CGGCAGCCGTCGGAGGCGGGCTGTATCTGTCAGATCTGAACATGAGCTCTGATGAGGAAGCCCCGGCTCA
GGGCGAACCCGCACCGGATATGACCGGGGTGGTCGACAGCAGCTTCAACAGTAAGGTGGAGCAGCACGCG
ACAACAGAAATGCAGGCGACTGCCGCTGATCTCAACAAGCGTTTTGACTCCCTGCAGGGGGAAGTGGACC
TACTGAGTAAGGCGCGAAGCGCTGACCAGATACGTATCGACAAACTCAGCAGTGACAATGAAGCCATGCA
GAATCAGCTGAAGGCGCTGGGCGTGAAACCGGCTGTCTCTGGTGGCGAGCCCGCGCCGACTCCTCCGTCA
CCGCCACCCGGTCCGGAAGGGGAGCCGCAGCCAGCCAGTTATCCGCCGCAAACCGGCGCCGCGGTACCGC
CTCCGACGGCATTCTATCCGGGGAATGGTATGACACCGCCGCCGCAGGTCAGCTACCAGTCTGTACCGGT
ACCAAACCAGATACAGCGTAAAACGTTCAGTTATGACAAAGGAAAGAAAGCGAAGTCATTGCCGTACATT
CCGTCGGGGAGCTTTGCAAAAAGCATGCTTATCGAGGGGGCAGATGCCAACGCGTCTGTTACCGGGAATG
AATCCACTGTACCGATGCAGCTGCGTATCACCGGTCGCGTGGAAATGCCAAACAGCAAAACCTATGACCT
GACCGGCTGCTTTGTGGGGCTTGAAGCCTGGGGTGATGTATCGAGTGAGCGCGCCATTGTCCGTACCCGT
AATATCAGCTGTATCAAAGGTGATAAAACCATCGATCAGCCCATTAACGGCCACGTTTCCTTTATGGGGA
AAAACGGGGTTAAGGGAGAGGTGGTGATGCGTAACGGAAAAATCCTCGGCTGGGCATGGGGGGCCGGTTT
TGTTGACGGGATTGGCCAGGGCATGGAACGCGCTTCACAGCCGGCAGTTGGCCTGGGGGCAACCGCATCT
GTTGGCGCCGGTGATGTTCTGAAAATGGGTGTCGGCGGTGGTGCATCTAAAGCTGCGCAGACGCTGAGCG
AGTACTACATCAAAAGGGCTGAGCAGTATCACCCGGTCATTCCGATTGGTGCCGGTAACGAAGTGACTGT
CGTGTTCCAGGATGGATTTCAGCTGAAAACCATCGAAGAGCTGGAAGCGGAAAAGAACGGGCAACAGCAG
GCTCAGAATCAGGAGGCGGAGCCGGCACCGCAGGCTGATGCACATCATCAGTCAGGCGGCGGTATGAACG
GATTCAATACTGACGAGATGCTGAAGAAGCTGGGCAAACTTGATCCGCGTGAGTTCTCTCCGGGCGCAGC
GCCGCAGGGGGAAAATAATGGCTAA
 Primer design