SecReT4
Protein ID: 152973568
T4SS name [ID]Tra_F [112]
Gene symboltraV
Locus tagKPN_pKPN3p06010
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN3 [GenBank: NC_009649] [Browse all T4SS(s) in this replicon]
Location [Strand]146620..147189 [+]
Productconjugal transfer protein TraV
Component typeTraV_F
UniProt IDA6TIG6
KEGG IDkpn:KPN_pKPN3p06010
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 5.1e-39, Aligned region: 23..183
Protein Sequence: 189 a.a.     [Download]
>gi|152973568|ref|YP_001338619.1| conjugal transfer protein TraV [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MKELMLLIPLGSALLLTGCAGTETEFQCNATTSDTCMTMEQANEKAKLKEERSDAKPAAAGLPRLADGNF
RTTSPNSYPLPPQPVINPGRNTAPSVTVSNKPGFLNTVPVNYDDVLRTRTAPVYIRPVSLSTYTSPATIP
GNYPRPLRNGEETTSLWIAPYVDADDVYHQPATVLFVVKPSAWGQPRLN
 
Nucleotide Sequence: 570 bp     [Download]
>gi|152973416|ref|NC_009649.1|:146620-147189 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence
ATGAAGGAATTAATGCTGTTAATTCCTCTGGGCAGCGCTTTGCTCTTAACCGGGTGTGCGGGCACAGAGA
CCGAATTTCAATGTAATGCCACGACGTCGGATACCTGTATGACGATGGAACAGGCAAATGAAAAAGCTAA
GCTGAAAGAGGAACGCAGTGACGCAAAGCCGGCTGCGGCCGGATTGCCACGACTGGCTGACGGAAATTTC
AGAACGACGTCGCCAAACTCATATCCGCTGCCGCCACAGCCAGTAATTAATCCAGGGCGTAATACAGCGC
CATCTGTGACGGTGAGTAATAAACCCGGGTTCCTGAATACGGTACCGGTCAATTATGATGACGTCCTGAG
AACACGGACTGCTCCGGTATATATCAGGCCAGTTAGTCTTAGTACTTATACTTCTCCGGCGACAATTCCG
GGTAATTATCCCCGACCATTAAGAAACGGGGAGGAGACAACGTCATTGTGGATAGCGCCGTATGTGGATG
CAGATGATGTATATCACCAGCCGGCAACGGTTCTTTTTGTCGTAAAACCATCGGCGTGGGGACAACCTCG
CCTTAATTGA
 Primer design