SecReT4
Protein ID: 152973577
T4SS name [ID]Tra_F [112]
Gene symboltraW
Locus tagKPN_pKPN3p06019
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN3 [GenBank: NC_009649] [Browse all T4SS(s) in this replicon]
Location [Strand]152850..153476 [+]
Productconjugal transfer pilus assembly protein TraW
Component typeTraW_F
UniProt IDA6TIH5
KEGG IDkpn:KPN_pKPN3p06019
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 3.4e-07, Aligned region: 7..32
Protein Sequence: 208 a.a.     [Download]
>gi|152973577|ref|YP_001338628.1| conjugal transfer pilus assembly protein TraW [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MIRLKDCLLAACLVSPLTQAADLGTWGDLWPVREQDMLQLITQRLQSLQSSGQWDQTMDAFKQRVIENSQ
RPAPVEGIKRAEKYEQRWFDPSIRLTEDLKDNEGRVFARKGDVVNPLKTVPFVQTLYFINGDDADQLAWM
KRQVPETLMSKIILVRGSIPDTSAALDSRIYFDQNGVLSKRFGLTAVPARITPAPSGERLNIETFPVK
 
Nucleotide Sequence: 627 bp     [Download]
>gi|152973416|ref|NC_009649.1|:152850-153476 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence
ATGATACGACTGAAAGACTGTCTGCTCGCCGCCTGCCTGGTATCGCCGCTGACTCAGGCGGCTGATCTCG
GTACCTGGGGGGATTTATGGCCCGTCCGGGAGCAGGACATGCTGCAGCTCATCACGCAGCGTCTGCAGTC
ACTGCAATCCTCTGGCCAGTGGGACCAGACGATGGATGCGTTTAAGCAGCGGGTTATCGAGAACAGTCAG
CGCCCGGCACCGGTGGAGGGCATTAAGCGTGCGGAGAAATACGAGCAGCGCTGGTTTGATCCCAGCATCC
GCCTGACCGAAGACCTGAAGGACAATGAGGGGCGGGTGTTTGCCCGCAAGGGCGATGTGGTGAACCCGCT
TAAAACCGTACCGTTTGTCCAGACCCTGTACTTCATCAATGGAGACGATGCCGACCAGCTGGCCTGGATG
AAGCGTCAGGTGCCGGAAACCCTGATGAGCAAAATTATCCTGGTGCGTGGCAGTATCCCGGACACCTCCG
CAGCGCTGGACAGCCGGATCTATTTCGACCAGAACGGCGTACTGAGCAAGCGATTTGGCCTGACGGCGGT
CCCGGCGCGGATCACGCCGGCGCCATCCGGTGAACGCCTGAATATTGAGACCTTCCCTGTAAAATAA
 Primer design