SecReT4
Protein ID: 152973579
T4SS name [ID]Tra_F [112]
Gene symboltrbC
Locus tagKPN_pKPN3p06021
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN3 [GenBank: NC_009649] [Browse all T4SS(s) in this replicon]
Location [Strand]154501..155130 [+]
Productconjugal transfer pilus assembly protein TrbC
Component typeTrbC_F
UniProt IDA6TIH7
KEGG IDkpn:KPN_pKPN3p06021
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 7.8e-29, Aligned region: 87..185
Protein Sequence: 209 a.a.     [Download]
>gi|152973579|ref|YP_001338630.1| conjugal transfer pilus assembly protein TrbC [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MNLFMVMLLLTGRAVLAETSSVTDREWLKQQETLSEQLRQHPDKQLQQELEAQINRNPLPKSDRQFIDNL
VSQQKAANQEKPAEGALYFVSFSIPEEGLKRMLHETRQYGIPATLRGLVNNDMKTTTDAVLQLVKDGVTD
GVQIDPTLYTQYSIRSVPSLVVRCQAGYDVVRGNIHVKQALEKVAQTGDCAQVARQILDAPSNAAGSQP
 
Nucleotide Sequence: 630 bp     [Download]
>gi|152973416|ref|NC_009649.1|:154501-155130 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence
ATGAATCTGTTTATGGTCATGCTTTTGCTGACCGGACGAGCGGTGTTGGCTGAAACCTCCTCTGTTACAG
ACAGAGAATGGCTGAAGCAGCAGGAGACCCTCAGCGAACAGCTGCGCCAGCATCCGGATAAACAGCTGCA
GCAGGAGCTTGAGGCGCAAATCAACCGTAATCCTCTGCCCAAATCAGACCGCCAGTTTATCGATAATCTG
GTCAGCCAGCAGAAAGCGGCGAATCAGGAAAAGCCAGCAGAAGGGGCGCTGTACTTTGTCTCCTTCTCGA
TACCTGAAGAGGGGCTGAAGCGGATGCTGCACGAAACCCGGCAGTACGGCATTCCGGCGACACTGCGTGG
GCTCGTCAATAACGACATGAAGACCACCACTGACGCGGTGCTGCAGCTGGTGAAGGATGGCGTGACCGAC
GGCGTGCAGATCGACCCGACACTGTACACGCAGTACAGCATCCGGAGTGTGCCGTCTCTGGTGGTACGGT
GTCAGGCCGGATATGACGTGGTACGCGGTAACATTCACGTCAAACAGGCGCTGGAGAAAGTGGCACAAAC
CGGTGACTGCGCACAGGTGGCCCGGCAAATACTTGATGCGCCCTCGAATGCCGCCGGGAGCCAGCCATGA
 Primer design