SecReT4
Protein ID: 152973580
T4SS name [ID]Tra_F [112]
Gene symboltraN
Locus tagKPN_pKPN3p06022
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN3 [GenBank: NC_009649] [Browse all T4SS(s) in this replicon]
Location [Strand]155189..157144 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDA6TIH8
KEGG IDkpn:KPN_pKPN3p06022, kpn:KPN_pKPN4p07145
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 3.1e-71, Aligned region: 354..600
Protein Sequence: 651 a.a.     [Download]
>gi|152973580|ref|YP_001338631.1| conjugal transfer mating pair stabilization protein TraN [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MKTVISVLTAHFFVLSAFIWLASPACADRGSDYKAGSDFAKQVQGNGLNSLKNFSGEQNLPGYTDSPDQT
KYYGGVTASGDSSLKSDSALEFSQGDTGKAITESFTNRPPDQISQDAPFIQAAKDTESRADSIVGDTGQS
CTAQVVNRSEFTNHTCERDLQVENFCTREATLKDNATTQKVNRTYQQVVTLNYARSTRQWSGNLTIPTNG
RLLNASVDGEPLVIPWIEECDSEGKVRDSCKSAVSESLTLFERTFPIDVINWPRSESMCSGGQNTHCTKY
TYDGKGKIHQSFGVDKAVTAGQNFSVSKTSRTVSSASQKPVQVTVTLVMEETETVYAPEVVWVESCPFSK
DEGKKTGEECISPGGTRTITLGGRDYSFTEACWKYKDTWLTQPADNGSCESLMKNTACTLSSRQCAFSSE
EGTCLHEYATYSCETRTSGKQMICGGDVFCLDGECDKATSGKSNDFGQAVSELAALAAAGKDVAALNGVD
VRAFTGKAKFCKKFAAGFSNCCKDSGWGQDVGLARCSSEEKALAKAKKDKLTVSIGEFCSKKVLGICLEK
KRSYCQFDSKLAQIVQQQGRNGQLHIGFGGASSPDCRGITVAELQGIDFNKLDFTNFMDDLMKNQKIPEN
DVLTNKTRERIKEIMSQQSAQ
 
Nucleotide Sequence: 1956 bp     [Download]
>gi|152973416|ref|NC_009649.1|:155189-157144 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence
ATGAAGACGGTTATTTCCGTGCTGACTGCGCATTTTTTTGTCCTGAGCGCCTTTATCTGGCTGGCATCCC
CAGCCTGTGCTGACAGAGGAAGCGACTATAAAGCTGGTTCGGATTTTGCGAAACAGGTGCAGGGCAATGG
TCTGAACTCACTGAAAAATTTCAGTGGTGAGCAAAACCTGCCGGGGTATACCGACAGCCCTGATCAGACA
AAATACTATGGCGGCGTCACTGCCAGCGGAGACAGCTCTCTGAAAAGCGATTCAGCCCTGGAGTTCAGCC
AGGGAGATACCGGCAAAGCGATTACGGAGTCGTTCACGAACCGGCCACCGGATCAGATATCTCAGGATGC
GCCGTTTATTCAGGCCGCAAAGGATACAGAATCCCGTGCCGACAGCATTGTCGGCGATACCGGACAGTCC
TGTACCGCCCAGGTTGTGAACCGCAGTGAGTTCACAAACCATACCTGCGAACGTGATCTGCAGGTGGAAA
ATTTTTGCACACGGGAAGCGACCCTGAAGGATAACGCCACCACACAGAAAGTTAACCGAACCTATCAGCA
GGTGGTGACGCTGAATTATGCCCGGAGTACCCGGCAATGGAGTGGCAACCTGACGATCCCGACCAACGGT
CGTCTGCTGAATGCCTCGGTGGATGGTGAGCCTCTGGTGATCCCCTGGATTGAAGAATGCGATTCCGAAG
GGAAGGTGCGGGATAGCTGCAAGAGTGCAGTGAGTGAAAGCCTGACCCTCTTTGAACGAACGTTCCCCAT
TGATGTGATCAACTGGCCACGTTCAGAATCGATGTGTTCAGGCGGTCAGAACACGCATTGTACGAAATAT
ACCTATGACGGGAAGGGGAAGATTCATCAGTCGTTTGGTGTGGACAAAGCGGTCACTGCTGGGCAGAACT
TTTCAGTAAGCAAAACATCACGGACCGTATCATCGGCCAGCCAGAAACCCGTACAGGTCACGGTCACCCT
GGTGATGGAAGAAACCGAAACCGTCTATGCACCTGAAGTCGTCTGGGTTGAAAGCTGTCCGTTCAGTAAG
GATGAAGGAAAAAAAACGGGCGAGGAATGTATCAGTCCGGGAGGAACGCGAACCATCACCCTCGGAGGCA
GGGATTACTCGTTCACGGAGGCCTGCTGGAAATATAAGGATACCTGGCTCACGCAGCCGGCGGACAACGG
CTCCTGTGAAAGCCTGATGAAAAATACGGCCTGTACTCTGTCATCCCGCCAGTGCGCCTTCTCCAGCGAG
GAAGGCACGTGCCTGCATGAATATGCAACGTATTCCTGCGAAACCAGGACGAGTGGCAAGCAAATGATCT
GCGGCGGTGATGTCTTCTGCCTTGATGGTGAATGTGACAAAGCCACGTCCGGGAAGAGCAACGACTTTGG
GCAGGCGGTGTCTGAGCTGGCGGCACTGGCTGCCGCGGGGAAGGACGTCGCGGCACTGAACGGGGTGGAT
GTCCGGGCATTCACCGGAAAAGCGAAGTTCTGTAAGAAGTTTGCTGCCGGCTTCAGTAACTGCTGCAAAG
ACAGCGGCTGGGGCCAGGATGTGGGGCTGGCACGCTGCAGCAGCGAGGAAAAGGCGCTGGCCAAAGCGAA
AAAAGACAAGCTGACGGTCAGTATAGGGGAATTCTGCTCTAAAAAGGTTCTGGGGATTTGCCTGGAGAAA
AAAAGGAGCTATTGCCAGTTCGACTCAAAACTGGCGCAGATCGTTCAGCAGCAGGGAAGAAACGGTCAGC
TGCATATCGGTTTTGGCGGCGCCAGCAGTCCTGACTGTCGAGGCATTACCGTCGCGGAACTCCAGGGGAT
TGATTTTAACAAGCTGGATTTCACCAACTTTATGGACGACCTGATGAAAAATCAAAAAATACCGGAAAAC
GATGTGCTCACCAATAAGACCAGAGAACGAATTAAGGAAATCATGAGTCAGCAATCCGCGCAATAA
 Primer design