SecReT4
Protein ID: 152973584
T4SS name [ID]Tra_F [112]
Gene symboltraF
Locus tagKPN_pKPN3p06026
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN3 [GenBank: NC_009649] [Browse all T4SS(s) in this replicon]
Location [Strand]158016..158768 [+]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDA6TII2
KEGG IDkpn:KPN_pKPN3p06026, kpn:KPN_pKPN4p07149
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 5.4e-77, Aligned region: 26..240
Protein Sequence: 250 a.a.     [Download]
>gi|152973584|ref|YP_001338635.1| conjugal pilus assembly protein TraF [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MRTIHAAMLAGCLCCALMPAFAKDAGWQWYNEKLKPRDEDRKAVPAAPPPQMDILEKLATLQAATKRSLY
EAILYPSSENFVKYFRLQNYWTQQAGLFSMSAKKAMLENPELDYNLQYSHYNGTVKNQLAADYAEQRQAI
STLAQHYGVMFFYRGREAIDGQLVQVIKNFRETYGLSVIPVSVDGVINPMLPDSRTDQGQAEQLGVKFFP
AMMLVNPKSGQVKPLSYGFISQDDLAKQFLYVSSDFKPNF
 
Nucleotide Sequence: 753 bp     [Download]
>gi|152973416|ref|NC_009649.1|:158016-158768 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence
ATGCGAACAATACATGCCGCCATGCTGGCGGGGTGCCTTTGCTGCGCCCTGATGCCGGCTTTCGCCAAAG
ACGCGGGCTGGCAGTGGTACAACGAGAAACTGAAGCCCCGTGATGAGGACAGGAAAGCCGTACCAGCGGC
ACCACCGCCGCAAATGGATATTCTGGAGAAACTCGCCACACTCCAGGCGGCCACCAAACGGTCGTTGTAC
GAAGCCATTCTGTATCCATCGTCTGAAAACTTCGTGAAGTATTTCCGGCTGCAGAACTACTGGACGCAGC
AGGCAGGTTTGTTCTCGATGAGTGCGAAGAAAGCCATGCTGGAAAACCCCGAACTCGATTACAACCTGCA
GTACAGCCACTACAACGGCACGGTAAAAAACCAGCTCGCTGCCGACTATGCCGAACAGCGACAGGCTATC
TCCACCCTCGCACAGCACTACGGCGTGATGTTCTTCTACCGGGGCCGGGAAGCGATCGATGGCCAGCTGG
TCCAGGTGATTAAAAATTTTCGCGAAACCTATGGCCTGAGCGTGATACCGGTGTCGGTTGACGGAGTGAT
TAACCCCATGCTGCCCGACAGCCGGACGGACCAGGGCCAGGCAGAGCAGCTTGGCGTGAAGTTCTTCCCC
GCGATGATGCTGGTTAACCCGAAAAGTGGCCAGGTGAAGCCTCTCAGTTACGGCTTTATCAGTCAGGACG
ACCTGGCGAAACAGTTCCTCTATGTCTCCAGCGACTTTAAACCGAATTTCTAA
 Primer design