SecReT4
Protein ID: 152973585
T4SS name [ID]Tra_F [112]
Gene symboltraQ
Locus tagKPN_pKPN3p06027
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN3 [GenBank: NC_009649] [Browse all T4SS(s) in this replicon]
Location [Strand]158737..159018 [+]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDA6TII3
KEGG IDkpn:KPN_pKPN3p06027
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 1.2e-34, Aligned region: 15..85
Protein Sequence: 93 a.a.     [Download]
>gi|152973585|ref|YP_001338636.1| conjugal transfer pilin chaperone TraQ [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MSPATLNRISKECVMRNIRFPDLDITGMWVLAVGVFFHLIARLVRKQPELAVQAGEIFGLGMVVFGGYRI
LNALIAEAEKEEKACEKQPDEPR
 
Nucleotide Sequence: 282 bp     [Download]
>gi|152973416|ref|NC_009649.1|:158737-159018 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence
ATGTCTCCAGCGACTTTAAACCGAATTTCTAAGGAGTGTGTCATGCGAAATATTCGTTTTCCGGATTTAG
ATATCACCGGGATGTGGGTGCTGGCCGTGGGCGTGTTTTTCCACCTGATAGCCCGGCTTGTCAGAAAACA
GCCTGAGCTGGCCGTCCAGGCCGGGGAAATCTTCGGGCTGGGTATGGTGGTGTTCGGGGGATACCGCATT
CTAAACGCCCTGATTGCTGAAGCCGAAAAAGAGGAGAAAGCCTGTGAAAAACAGCCTGATGAACCTCGCT
AA
 Primer design