SecReT4
Protein ID: 152973588
T4SS name [ID]Tra_F [112]
Gene symboltraH
Locus tagKPN_pKPN3p06030
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN3 [GenBank: NC_009649] [Browse all T4SS(s) in this replicon]
Location [Strand]160014..161393 [+]
Productconjugal transfer pilus assembly protein TraH
Component typeTraH_F
UniProt IDA6TII6
KEGG IDkpn:KPN_pKPN3p06030
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 5.3e-118, Aligned region: 32..381
Protein Sequence: 459 a.a.     [Download]
>gi|152973588|ref|YP_001338639.1| conjugal transfer pilus assembly protein TraH [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MEDWMRIKLLSLFCGAVLGLSFSAAADVNGDMNNFFNKLGFASNTSQPQVWQGQAAGYASGGSLYARTQV
KTIQLVSMTLPDINAGCGGIDAYLGSFSYINSEQLQRFAKQIMSNAAGYFFDLALQTTVPEIKTAKDFLQ
KMATDMNSMNLSSCQAAQGIVGGLFPRTQVAQQKVCQDIAGESNIFSDWAASRQGCTVGGKMDSVQDKAS
DKDKERVMKNINIMWNALSKNRLFDGNKELKEFIMTLTGTLIFGENSEITPLPARTTDQDLIRAMMEGGT
AKIYHCNDSDKCLKVVADATVTITSNKALKSQISALLSSIQNKAVADEKLTDQEKGFISSTTIPVFKYLV
DPQMLGVSNSLIYQLTDYIGYDILLQYIQELIQQARAMISTGNYPQSTMDMIMENLNQASVQIAAFQSRV
QVQQDALLVVDRQMSYMRQQVSARMMTRYQNNYHFGGNL
 
Nucleotide Sequence: 1380 bp     [Download]
>gi|152973416|ref|NC_009649.1|:160014-161393 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence
ATGGAGGACTGGATGCGAATTAAACTTCTGTCACTCTTCTGCGGTGCCGTGCTTGGCCTGTCATTTAGCG
CCGCCGCCGACGTGAATGGCGATATGAACAACTTCTTCAATAAGCTGGGCTTTGCGTCCAATACCAGCCA
GCCGCAGGTCTGGCAGGGACAGGCTGCGGGTTACGCCTCCGGCGGTTCGCTGTATGCCAGAACGCAGGTG
AAAACGATCCAGCTGGTCAGCATGACGCTCCCTGATATTAATGCCGGCTGCGGAGGGATTGATGCCTATC
TGGGGTCATTCAGCTATATCAACAGCGAGCAGCTGCAGAGGTTCGCAAAACAAATCATGAGCAACGCCGC
GGGGTACTTTTTTGATCTCGCTTTGCAAACCACGGTACCGGAGATTAAAACCGCAAAGGACTTCCTTCAA
AAGATGGCCACTGACATGAACAGCATGAACCTCAGTTCCTGCCAGGCTGCTCAGGGAATTGTGGGTGGCC
TGTTTCCTCGTACCCAGGTCGCTCAACAAAAGGTCTGCCAGGACATTGCCGGTGAAAGCAATATCTTTTC
GGACTGGGCCGCGTCGCGCCAGGGTTGTACGGTGGGCGGCAAGATGGACAGCGTCCAGGATAAGGCCAGC
GATAAAGACAAAGAACGTGTGATGAAAAACATCAACATCATGTGGAATGCCTTATCGAAGAACCGGCTCT
TCGACGGCAATAAGGAGCTGAAGGAATTCATCATGACGCTCACCGGTACGCTGATTTTCGGGGAGAACAG
TGAAATCACGCCGCTGCCGGCACGCACCACTGACCAGGATCTGATTAGAGCCATGATGGAGGGCGGCACG
GCTAAAATCTACCACTGCAATGATTCGGATAAGTGTCTTAAGGTCGTTGCTGATGCGACCGTGACCATCA
CTTCCAATAAAGCGCTAAAAAGCCAGATTTCCGCTTTGTTAAGCAGTATCCAGAATAAAGCAGTGGCTGA
TGAAAAACTGACGGATCAGGAGAAAGGGTTTATCTCCAGCACCACCATTCCGGTATTCAAATACCTGGTC
GATCCGCAGATGCTCGGGGTGTCTAACTCACTTATTTACCAGCTGACGGACTATATCGGCTACGACATCC
TGCTGCAGTACATTCAGGAACTTATCCAGCAGGCCCGGGCGATGATTTCAACCGGTAATTATCCCCAGTC
GACAATGGATATGATCATGGAAAACCTCAATCAGGCGAGTGTCCAGATTGCCGCTTTTCAGTCCCGTGTT
CAGGTTCAGCAGGACGCCTTGCTTGTGGTTGACAGGCAAATGAGTTACATGCGCCAGCAGGTCTCTGCCC
GCATGATGACCCGCTACCAGAATAACTATCATTTTGGGGGGAATCTGTAA
 Primer design