SecReT4
Protein ID: 152973589
T4SS name [ID]Tra_F [112]
Gene symboltraG
Locus tagKPN_pKPN3p06031
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN3 [GenBank: NC_009649] [Browse all T4SS(s) in this replicon]
Location [Strand]161393..164242 [+]
Productconjugal transfer mating pair stabilization protein TraG
Component typeTraG_F
UniProt IDA6TII7
KEGG IDkpn:KPN_pKPN3p06031, kpn:KPN_pKPN4p07154
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 6.6e-125, Aligned region: 3..451
Protein Sequence: 949 a.a.     [Download]
>gi|152973589|ref|YP_001338640.1| conjugal transfer mating pair stabilization protein TraG [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MLEIYAIAGGDWLRGNLNAIAAFMGTSTWSTIEKMCIAISVLIVAGNWVKKHNVMDLIGWVFSLTLVSML
VVIRTPVQIIDYSNVAQVYEVDNVPIGLAIPASLTTRVGNALIQSYEMVFALPDSVTYSKTGMLFGSNLV
AKSTDFLSQNPQITTLFSDYVQNCVMGDIFLNHKYSFEELLNSPDPYTLIFANPSPLRGVFDKNNQFQTC
EEASRDLKSALALDTQTGGKTWNYYVRQLFGGKPNPDLLFSQMIGDSYNYFYSSGQSAGQIIRQNVTMNA
LRSGIQSYAARSGDTASLVNIANTSSLEKQRLAQATMGHQALRTLPLMQTVIMGIMIGMFPIMVMAAMFN
MMTLQVLKGYVFALIWLQTWPLLFAILNSAMAYYAKQNGVPVVLSELSQVQLKNSDIATTAGYIAVMIPP
LSWGIVKSMGAAFSSAYSHFSSSGLGATSQAASGVVDGNYSFANMQMENVSGYSWGTNSTTSFGQMSRQL
ANGGMSTQTRDGSMVWDSGGAMSKLPVDINVGRQIASAQQQMAREADVQAESALHGYNSSVTSAWNVLKQ
FGTNRGTSSSMTTGADNTESSQDTMAKSKMWNAVVANAKANNISNEQSFQNLMDESTRGTVTGEAHVGAR
WSSGDQLAGKIGKLATGASVEGGIKGSISGSGSTGSTDTVGQSGRHSSDSRHDISSQAAKDFREASDYLV
SHKTNTSGNITDNNASSRVDQFAASLSSAKNSYDQYTTSRTRSHEYSEMASRTESLTGQMSENLTQQFAN
FVQHRAPQDAEAILTNTSSPEIAAQREMLAREFVKAQVEPRIDSSFEQGRNDIGNGMASVSGTPGDQTVV
SDFGKHSGDIESMSRNSGIKENVRNQVDSMVEDNTRINNAGKINIKEQGEGIKQQNADFEMLHKKEGNDF
NERYNKELNGQVNNPLSNTTEEFRKKAEESARKMDGKLP
 
Nucleotide Sequence: 2850 bp     [Download]
>gi|152973416|ref|NC_009649.1|:161393-164242 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence
ATGCTTGAGATATATGCCATTGCTGGCGGCGACTGGTTACGGGGCAACCTGAACGCGATTGCGGCGTTTA
TGGGGACCAGCACATGGTCGACTATAGAAAAGATGTGTATCGCCATCTCGGTACTCATTGTGGCGGGGAA
CTGGGTAAAAAAACACAACGTAATGGACCTTATTGGCTGGGTCTTTTCCCTCACCCTGGTCTCTATGCTG
GTTGTCATTCGTACCCCTGTGCAGATCATCGATTACAGTAACGTTGCGCAGGTCTATGAAGTCGATAATG
TTCCTATTGGTCTTGCCATTCCTGCGTCGCTGACAACGAGGGTGGGAAACGCGCTTATCCAGAGTTATGA
GATGGTCTTCGCGCTGCCGGACAGCGTCACGTACAGTAAAACGGGGATGTTATTTGGCAGTAATCTGGTC
GCGAAAAGTACGGATTTTTTGTCACAAAATCCTCAGATTACGACGCTGTTTTCCGATTACGTACAAAACT
GTGTGATGGGCGATATTTTCCTCAATCATAAGTACTCTTTTGAAGAATTACTGAATTCTCCTGATCCGTA
TACCCTGATTTTTGCTAACCCGAGTCCACTGCGTGGCGTGTTTGATAAAAACAACCAGTTCCAGACATGC
GAGGAGGCCTCACGGGATCTGAAATCGGCTCTTGCGCTGGATACTCAGACAGGCGGTAAAACCTGGAACT
ACTATGTTCGTCAGCTGTTTGGCGGCAAACCTAATCCCGATCTGCTGTTCAGCCAGATGATTGGCGACAG
CTACAATTACTTCTACAGCTCGGGACAGAGCGCCGGGCAGATTATCCGCCAGAACGTCACGATGAACGCC
CTGCGCAGCGGGATCCAGAGTTATGCAGCCCGCAGCGGCGATACCGCCAGTCTGGTCAATATCGCTAACA
CCTCATCCCTTGAAAAGCAGCGGCTGGCACAGGCCACAATGGGGCACCAGGCGCTTCGCACACTTCCGCT
GATGCAGACCGTTATCATGGGGATAATGATTGGGATGTTCCCGATCATGGTGATGGCCGCCATGTTTAAT
ATGATGACGCTGCAGGTGTTAAAGGGGTATGTGTTTGCGCTTATCTGGCTGCAGACGTGGCCATTACTGT
TCGCCATCCTGAACAGCGCAATGGCCTACTATGCGAAGCAAAATGGCGTCCCGGTTGTTCTCTCTGAGTT
GTCGCAGGTTCAGCTCAAAAACTCGGATATTGCGACCACCGCGGGTTATATTGCCGTGATGATACCGCCT
TTGTCGTGGGGGATCGTGAAGAGCATGGGAGCCGCCTTCTCCAGTGCCTACAGCCATTTTTCTTCTTCCG
GGCTTGGTGCAACATCGCAGGCGGCTTCCGGCGTGGTGGATGGCAATTACTCGTTTGCCAACATGCAGAT
GGAGAACGTCAGCGGCTACAGCTGGGGTACCAACAGCACAACCAGTTTCGGACAGATGTCGCGGCAGCTG
GCGAATGGAGGCATGAGCACGCAGACGCGGGATGGCTCGATGGTCTGGGACAGTGGTGGTGCAATGTCAA
AACTGCCGGTGGATATCAACGTCGGTCGTCAGATAGCCAGTGCGCAGCAACAGATGGCCCGTGAGGCTGA
TGTCCAGGCCGAAAGCGCGCTGCATGGCTATAACAGCAGCGTGACAAGTGCCTGGAATGTTTTAAAGCAG
TTTGGTACCAACAGAGGAACCAGTTCCTCAATGACGACTGGAGCAGATAATACAGAGTCGTCGCAAGACA
CAATGGCTAAAAGTAAGATGTGGAATGCGGTGGTTGCTAATGCAAAAGCAAATAATATATCTAATGAGCA
GTCCTTTCAGAATCTCATGGATGAATCCACTAGAGGTACAGTTACAGGTGAAGCCCATGTGGGTGCAAGA
TGGAGTTCAGGAGATCAGCTTGCTGGTAAAATTGGGAAATTGGCTACAGGCGCCAGTGTAGAAGGTGGCA
TAAAAGGATCAATAAGTGGGAGCGGCAGCACAGGATCAACTGATACTGTTGGCCAGTCTGGTCGACATTC
CAGCGATAGCAGACATGATATAAGTAGTCAGGCCGCTAAAGATTTTAGAGAGGCAAGTGATTATCTTGTT
AGCCATAAAACTAATACTTCAGGTAATATAACTGATAACAATGCAAGCTCTCGTGTCGATCAGTTTGCTG
CTTCACTTTCTAGTGCTAAAAATAGTTACGACCAGTACACAACCAGTAGAACACGCAGCCATGAATATAG
TGAAATGGCTTCAAGAACTGAGAGTTTGACTGGCCAGATGAGCGAGAATCTCACTCAGCAATTTGCGAAC
TTTGTTCAGCATCGTGCTCCACAGGATGCTGAGGCCATTCTGACCAATACAAGCTCTCCTGAAATTGCAG
CGCAGCGTGAGATGCTGGCACGAGAGTTTGTGAAAGCTCAAGTAGAACCACGAATCGACAGTTCCTTTGA
ACAAGGAAGAAATGATATAGGTAATGGTATGGCAAGTGTTTCCGGGACGCCAGGTGACCAAACTGTTGTT
AGCGATTTTGGCAAGCACAGTGGTGATATTGAGTCAATGTCACGAAATTCTGGTATTAAAGAGAACGTAA
GAAATCAAGTGGATTCTATGGTGGAAGATAACACCAGGATAAATAATGCTGGTAAAATCAATATCAAAGA
GCAAGGTGAAGGGATTAAACAACAGAATGCAGATTTTGAGATGTTACATAAAAAAGAAGGAAATGACTTT
AATGAGCGATATAATAAGGAATTGAATGGTCAAGTGAACAATCCACTAAGCAACACGACTGAGGAGTTCA
GGAAGAAGGCTGAAGAATCTGCAAGGAAAATGGATGGTAAATTACCATAA
 Primer design